"RBM6" Related Products

Recombinant Human RBM6, His-tagged

Cat.No.: RBM6-30932TH
Product Overview: Recombinant fragment, corresponding to amino acids 152-386 of Human RBM6 with N terminal His tag. Observed mwt: 27 kDa ;
Description: RNA-binding protein 6 is a protein that in humans is encoded by the RBM6 gene. RBM6 orthologshave been identified in all mammals for which complete genome data are available.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitute with 93 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: HMNYRDRDAHAVDFRGRDAPPSDFRGRGTYDLDFRGRDGS HADFRGRDLSDLDFRAREQSRSDFRNRDVSDLDFRDKD GTQVDFRGRGSGTTDLDFRDRDTPHSDFRGRHRSRTDQDF RGREMGSCMEFKDREMPPVDPNILDYIQPSTQDREHSG MNVNRREESTHDHTIERPAFGIQKGEFEHSETREGETQ GVAFEHESPADFQNSQSPVQDQDKSQLSGREEQSSDAGLF K
Gene Name: RBM6 RNA binding motif protein 6 [ Homo sapiens ]
Official Symbol: RBM6
Synonyms: RBM6; RNA binding motif protein 6; RNA-binding protein 6; 3G2; DEF 3; DEF3; g16; NY LU 12;
Gene ID: 10180
mRNA Refseq: NM_001167582
Protein Refseq: NP_001161054
MIM: 606886
Uniprot ID: P78332
Chromosome Location: 3p21.3
Function: DNA binding; RNA binding; nucleic acid binding; nucleotide binding; zinc ion binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.