Recombinant Human RBP1

• Cat.No.: RBP1-30075TH
• Product Overview: Recombinant full length Human RBP1 with N-terminal proprietary tag.Mol Wt 40.92 kDa inclusive of tag.

Specification

• Description: This gene encodes the carrier protein involved in the transport of retinol (vitamin A alcohol) from the liver storage site to peripheral tissue. Vitamin A is a fat-soluble vitamin necessary for growth, reproduction, differentiation of epithelial tissues, and vision. Multiple transcript variants encoding different isoforms have been found for this gene.
• Protein length: 135 amino acids
• Molecular Weight: 40.920kDa inclusive of tags
• Source: Wheat germ
• Tissue specificity: Detected in nearly all the tissues with higher expression in adult ovary, pancreas, pituitary gland and adrenal gland, and fetal liver.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: MPVDFTGYWKMLVNENFEEYLRALDVNVALRKIANLLKPD KEIVQDGDHMIIRTLSTFRNYIMDFQVGKEFEEDLTGIDD RKCMTTVSWDGDKLQCVQKGEKEGRGWTQWIEGDELHLEM RVEGVVCKQVFKKVQ
• Sequence Similarities: Belongs to the calycin superfamily. Fatty-acid binding protein (FABP) family.

Gene Information

• Gene Name: RBP1 retinol binding protein 1, cellular [ Homo sapiens ]
• Official Symbol: RBP1
• Synonyms: RBP1; retinol binding protein 1, cellular; retinol-binding protein 1; CRABP I; CRBP; CRBP1; CRBPI; RBPC
• Gene ID: 5947
• mRNA Refseq: NM_001130992
• Protein Refseq: NP_001124464
• MIM: 180260
• Uniprot ID: P09455
• Chromosome Location: 3q21-q23
• Pathway: Retinoic acid receptors-mediated signaling, organism-specific biosystem; Vitamin A and carotenoid metabolism, organism-specific biosystem
• Function: lipid binding; retinal binding; retinoid binding; retinol binding; transporter activity