Active Recombinant Full Length Human RBP1 Protein, C-Flag-tagged
| Cat.No. : | RBP1-329HFL |
| Product Overview : | Recombinant Full Length Human RBP1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Mammalian Cells |
| Tag : | Flag |
| Description : | This gene encodes the carrier protein involved in the transport of retinol (vitamin A alcohol) from the liver storage site to peripheral tissue. Vitamin A is a fat-soluble vitamin necessary for growth, reproduction, differentiation of epithelial tissues, and vision. Multiple transcript variants encoding different isoforms have been found for this gene. |
| Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
| Bio-activity : | Enzyme activity regulator |
| Molecular Mass : | 15.7 kDa |
| AA Sequence : | MPVDFTGYWKMLVNENFEEYLRALDVNVALRKIANLLKPDKEIVQDGDHMIIRTLSTFRNYIMDFQVGKE FEEDLTGIDDRKCMTTVSWDGDKLQCVQKGEKEGRGWTQWIEGDELHLEMRVEGVVCKQVFKKVQTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
| Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Storage : | Store at -80 centigrade. |
| Concentration : | >50 ug/mL as determined by microplate BCA method. |
| Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Full Length : | Full L. |
| Gene Name | RBP1 retinol binding protein 1 [ Homo sapiens (human) ] |
| Official Symbol | RBP1 |
| Synonyms | CRBP; RBPC; CRBP1; CRBPI; CRABP-I |
| Gene ID | 5947 |
| mRNA Refseq | NM_002899.5 |
| Protein Refseq | NP_002890.2 |
| MIM | 180260 |
| UniProt ID | P09455 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RBP1 Products
Required fields are marked with *
My Review for All RBP1 Products
Required fields are marked with *
