Active Recombinant Full Length Human RBP1 Protein, C-Flag-tagged
Cat.No. : | RBP1-329HFL |
Product Overview : | Recombinant Full Length Human RBP1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes the carrier protein involved in the transport of retinol (vitamin A alcohol) from the liver storage site to peripheral tissue. Vitamin A is a fat-soluble vitamin necessary for growth, reproduction, differentiation of epithelial tissues, and vision. Multiple transcript variants encoding different isoforms have been found for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Bio-activity : | Enzyme activity regulator |
Molecular Mass : | 15.7 kDa |
AA Sequence : | MPVDFTGYWKMLVNENFEEYLRALDVNVALRKIANLLKPDKEIVQDGDHMIIRTLSTFRNYIMDFQVGKE FEEDLTGIDDRKCMTTVSWDGDKLQCVQKGEKEGRGWTQWIEGDELHLEMRVEGVVCKQVFKKVQTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | RBP1 retinol binding protein 1 [ Homo sapiens (human) ] |
Official Symbol | RBP1 |
Synonyms | CRBP; RBPC; CRBP1; CRBPI; CRABP-I |
Gene ID | 5947 |
mRNA Refseq | NM_002899.5 |
Protein Refseq | NP_002890.2 |
MIM | 180260 |
UniProt ID | P09455 |
◆ Recombinant Proteins | ||
RBP1-4746H | Recombinant Human Retinol Binding Protein 1, Cellular, His-tagged | +Inquiry |
RBP1-2744H | Recombinant Human RBP1 Protein (Asp64-Gln197), His tagged | +Inquiry |
RBP1-4970R | Recombinant Rat RBP1 Protein | +Inquiry |
Rbp1-598R | Recombinant Rat Rbp1 Protein, His-tagged | +Inquiry |
RBP1-12152Z | Recombinant Zebrafish RBP1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
RBP1-2457HCL | Recombinant Human RBP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RBP1 Products
Required fields are marked with *
My Review for All RBP1 Products
Required fields are marked with *
0
Inquiry Basket