Recombinant Human RBPJ, His-tagged

• Cat.No.: RBPJ-31301TH
• Product Overview: Recombinant fragment, corresponding to amino acids 94-485 of Human RBPJK Isoform 4 with an N terminal His tag; Predicted MWt 45 kDa.

Specification

• Description: The protein encoded by this gene is a transcriptional regulator important in the Notch signaling pathway. The encoded protein acts as a repressor when not bound to Notch proteins and an activator when bound to Notch proteins. It is thought to function by recruiting chromatin remodeling complexes containing histone deacetylase or histone acetylase proteins to Notch signaling pathway genes. Also, this protein can bind specifically to the recombination signal sequence of immunglobulin kappa type J segments. Several transcript variants encoding different isoforms have been found for this gene, and several pseudogenes of this gene exist on chromosome 9.
• Conjugation: HIS
• Source: E. coli
• Form: Lyophilised:Reconstitute with 72 μl aqua dest.
• Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: DQEMQQLNLEGKNYCTAKTLYISDSDKRKHFMLSVKMFYG NSDDIGVFLSKRIKVISKPSKKKQSLKNADLCIASGTK VALFNRLRSQTVSTRYLHVEGGNFHASSQQWGAFFIHL LDDDESEGEEFTVRDGYIHYGQTVKLVCSVTGMALPRL IIRKVDKQTALLDADDPVSQLHKCAFYLKDTERMYLCLSQ ERIIQFQATPCPKEPNKEMINDGASWTIISTDKAEYTF YEGMGPVLAPVTPVPVVESLQLNGGGDVAMLELTGQNF TPNLRVWFGDVEAETMYRCGESMLCVVPDISAFREGWR WVRQPVQVPVTLVRNDGIIYSTSLTFTYTPEPGPRPHC SAAGAILRANSSQVPPNESNTNSEGSYTNASTNSTSVTSS TATVVS
• Sequence Similarities: Belongs to the Su(H) family.Contains 1 IPT/TIG domain.

Gene Information

• Gene Name: RBPJ recombination signal binding protein for immunoglobulin kappa J region [ Homo sapiens ]
• Official Symbol: RBPJ
• Synonyms: RBPJ; recombination signal binding protein for immunoglobulin kappa J region; IGKJRB1, RBPSUH, recombining binding protein suppressor of hairless (Drosophila); recombining binding protein suppressor of hairless; CBF1; IGKJRB; KBF2; RBP J; RBPJK; SUH; sup
• Gene ID: 3516
• mRNA Refseq: NM_005349
• Protein Refseq: NP_005340
• MIM: 147183
• Uniprot ID: Q06330
• Chromosome Location: 4p15.2
• Pathway: Delta-Notch Signaling Pathway, organism-specific biosystem; Developmental Biology, organism-specific biosystem; Gene Expression, organism-specific biosystem; Generic Transcription Pathway, organism-specific biosystem; NICD traffics to nucleus, organism-specific biosystem
• Function: DNA binding; RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in positive regulation of transcription; protein binding; recombinase activity; sequence-specific DNA binding transcription f