Recombinant Human RBPJ protein(91-170 aa), C-His-tagged
Cat.No. : | RBPJ-2829H |
Product Overview : | Recombinant Human RBPJ protein(Q06330)(91-170 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 91-170 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | GCSEQESQPCAFIGIGNSDQEMQQLNLEGKNYCTAKTLYISDSDKRKHFMLSVKMFYGNSDDIGVFLSKRIKVISKPSKK |
Gene Name | RBPJ recombination signal binding protein for immunoglobulin kappa J region [ Homo sapiens ] |
Official Symbol | RBPJ |
Synonyms | RBPJ; recombination signal binding protein for immunoglobulin kappa J region; IGKJRB1, RBPSUH, recombining binding protein suppressor of hairless (Drosophila); recombining binding protein suppressor of hairless; CBF1; IGKJRB; KBF2; RBP J; RBPJK; SUH; suppressor of hairless homolog (Drosophila); CBF-1; RBP-JK; RBP-J kappa; H-2K binding factor-2; suppressor of hairless homolog; renal carcinoma antigen NY-REN-30; immunoglobulin kappa J region recombination signal binding protein 1; csl; RBP-J; RBPSUH; IGKJRB1; MGC61669; |
Gene ID | 3516 |
mRNA Refseq | NM_005349 |
Protein Refseq | NP_005340 |
MIM | 147183 |
UniProt ID | Q06330 |
◆ Recombinant Proteins | ||
Rbpj-5429M | Recombinant Mouse Rbpj Protein, Myc/DDK-tagged | +Inquiry |
RBPJ-5292H | Recombinant Human RBPJ Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
RBPJ-13H | Recombinant Human RBPJ protein, MYC/DDK-tagged | +Inquiry |
RBPJ-31301TH | Recombinant Human RBPJ, His-tagged | +Inquiry |
RBPJ-3645R | Recombinant Rhesus Macaque RBPJ Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RBPJ-2454HCL | Recombinant Human RBPJ 293 Cell Lysate | +Inquiry |
RBPJ-2453HCL | Recombinant Human RBPJ 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RBPJ Products
Required fields are marked with *
My Review for All RBPJ Products
Required fields are marked with *
0
Inquiry Basket