"RENBP" Related Products

Expand
Expand
Expand

Recombinant Human RENBP

Cat.No.: RENBP-30477TH
Product Overview: Recombinant fragment corresponding to amino acids 311-410 of Human RENBP with an N terminal proprietary tag; Predicted MWt 36.63 kDa inclusive of tag.
Description: The gene product inhibits renin activity by forming a dimer with renin, a complex known as high molecular weight renin. The encoded protein contains a leucine zipper domain, which is essential for its dimerization with renin. The gene product can catalyze the interconversion of N-acetylglucosamine to N-acetylmannosamine, indicating that it is a GlcNAc 2-epimerase. Transcript variants utilizing alternative promoters have been described in the literature.
Protein length: 100 amino acids
Molecular Weight: 36.630kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: FCPTQLEWAMKLWWPHSEAMIAFLMGYSDSGDPVLLRLFYQVAEYTFRQFRDPEYGEWFGYLSREGKVALSIKGGPFKGCFHVPRCLAMCEEMLGALLSR
Sequence Similarities: Belongs to the N-acylglucosamine 2-epimerase family.
Gene Name: RENBP renin binding protein [ Homo sapiens ]
Official Symbol: RENBP
Synonyms: RENBP; renin binding protein; N-acylglucosamine 2-epimerase; GlcNAc 2 epimerase; N acetyl D glucosamine 2 epimerase; N acylglucosamine 2 epimerase; RBP; RNBP;
Gene ID: 5973
mRNA Refseq: NM_002910
Protein Refseq: NP_002901
MIM: 312420
Uniprot ID: P51606
Chromosome Location: X
Pathway: Amino sugar and nucleotide sugar metabolism, organism-specific biosystem; Amino sugar and nucleotide sugar metabolism, conserved biosystem;
Function: ATP binding; N-acylglucosamine 2-epimerase activity; endopeptidase inhibitor activity; enzyme inhibitor activity; isomerase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.