"RGL2" Related Products

Expand

Recombinant Human RGL2

Cat.No.: RGL2-30740TH
Product Overview: Recombinant fragment of Human RGL2 with N terminal proprietary tag; Predicted MW 36.63 kDa.
Description: Ral guanine nucleotide dissociation stimulator-like 2 is a protein that in humans is encoded by the RGL2 gene.
Protein length: 100 amino acids
Molecular Weight: 36.630kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: PGASDCRIIRVQMELGEDGSVYKSILVTSQDKAPSVISRVLKKNNRDSAVASEYELVQLLPGERELTIPASANVFYAMDGASHDFLLRQRRRSSTATPGV
Sequence Similarities: Contains 1 N-terminal Ras-GEF domain.Contains 1 Ras-associating domain.Contains 1 Ras-GEF domain.
Gene Name: RGL2 ral guanine nucleotide dissociation stimulator-like 2 [ Homo sapiens ]
Official Symbol: RGL2
Synonyms: RGL2; ral guanine nucleotide dissociation stimulator-like 2; RAB2, member RAS oncogene family like , RAB2L; HKE1.5; KE1.5;
Gene ID: 5863
mRNA Refseq: NM_001243738
Protein Refseq: NP_001230667
MIM: 602306
Uniprot ID: O15211
Chromosome Location: 6p21.3
Function: Ras guanyl-nucleotide exchange factor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.