Recombinant Human RGL2
Cat.No. : | RGL2-30740TH |
Product Overview : | Recombinant fragment of Human RGL2 with N terminal proprietary tag; Predicted MW 36.63 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 100 amino acids |
Description : | Ral guanine nucleotide dissociation stimulator-like 2 is a protein that in humans is encoded by the RGL2 gene. |
Molecular Weight : | 36.630kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | PGASDCRIIRVQMELGEDGSVYKSILVTSQDKAPSVISRVLKKNNRDSAVASEYELVQLLPGERELTIPASANVFYAMDGASHDFLLRQRRRSSTATPGV |
Sequence Similarities : | Contains 1 N-terminal Ras-GEF domain.Contains 1 Ras-associating domain.Contains 1 Ras-GEF domain. |
Gene Name | RGL2 ral guanine nucleotide dissociation stimulator-like 2 [ Homo sapiens ] |
Official Symbol | RGL2 |
Synonyms | RGL2; ral guanine nucleotide dissociation stimulator-like 2; RAB2, member RAS oncogene family like , RAB2L; HKE1.5; KE1.5; |
Gene ID | 5863 |
mRNA Refseq | NM_001243738 |
Protein Refseq | NP_001230667 |
MIM | 602306 |
Uniprot ID | O15211 |
Chromosome Location | 6p21.3 |
Function | Ras guanyl-nucleotide exchange factor activity; |
◆ Recombinant Proteins | ||
RGL2-3684R | Recombinant Rhesus Macaque RGL2 Protein, His (Fc)-Avi-tagged | +Inquiry |
RGL2-14124M | Recombinant Mouse RGL2 Protein | +Inquiry |
Rgl2-5486M | Recombinant Mouse Rgl2 Protein, Myc/DDK-tagged | +Inquiry |
RGL2-30740TH | Recombinant Human RGL2 | +Inquiry |
RGL2-6533Z | Recombinant Zebrafish RGL2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
RGL2-2390HCL | Recombinant Human RGL2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RGL2 Products
Required fields are marked with *
My Review for All RGL2 Products
Required fields are marked with *
0
Inquiry Basket