Recombinant Human RGL2

• Cat.No.: RGL2-30740TH
• Product Overview: Recombinant fragment of Human RGL2 with N terminal proprietary tag; Predicted MW 36.63 kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 100 amino acids
• Description: Ral guanine nucleotide dissociation stimulator-like 2 is a protein that in humans is encoded by the RGL2 gene.
• Molecular Weight: 36.630kDa inclusive of tags
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: PGASDCRIIRVQMELGEDGSVYKSILVTSQDKAPSVISRVLKKNNRDSAVASEYELVQLLPGERELTIPASANVFYAMDGASHDFLLRQRRRSSTATPGV
• Sequence Similarities: Contains 1 N-terminal Ras-GEF domain.Contains 1 Ras-associating domain.Contains 1 Ras-GEF domain.

Gene Information

• Gene Name: RGL2 ral guanine nucleotide dissociation stimulator-like 2 [ Homo sapiens ]
• Official Symbol: RGL2
• Synonyms: RGL2; ral guanine nucleotide dissociation stimulator-like 2; RAB2, member RAS oncogene family like , RAB2L; HKE1.5; KE1.5
• Gene ID: 5863
• mRNA Refseq: NM_001243738
• Protein Refseq: NP_001230667
• MIM: 602306
• Uniprot ID: O15211
• Chromosome Location: 6p21.3
• Function: Ras guanyl-nucleotide exchange factor activity