Recombinant Human RGL2

Cat.No. : RGL2-30740TH
Product Overview : Recombinant fragment of Human RGL2 with N terminal proprietary tag; Predicted MW 36.63 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 100 amino acids
Description : Ral guanine nucleotide dissociation stimulator-like 2 is a protein that in humans is encoded by the RGL2 gene.
Molecular Weight : 36.630kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : PGASDCRIIRVQMELGEDGSVYKSILVTSQDKAPSVISRVLKKNNRDSAVASEYELVQLLPGERELTIPASANVFYAMDGASHDFLLRQRRRSSTATPGV
Sequence Similarities : Contains 1 N-terminal Ras-GEF domain.Contains 1 Ras-associating domain.Contains 1 Ras-GEF domain.
Gene Name RGL2 ral guanine nucleotide dissociation stimulator-like 2 [ Homo sapiens ]
Official Symbol RGL2
Synonyms RGL2; ral guanine nucleotide dissociation stimulator-like 2; RAB2, member RAS oncogene family like , RAB2L; HKE1.5; KE1.5;
Gene ID 5863
mRNA Refseq NM_001243738
Protein Refseq NP_001230667
MIM 602306
Uniprot ID O15211
Chromosome Location 6p21.3
Function Ras guanyl-nucleotide exchange factor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RGL2 Products

Required fields are marked with *

My Review for All RGL2 Products

Required fields are marked with *

0
cart-icon