Recombinant Human RNF114, His-tagged RNF114-31567TH

Recombinant Human RNF114, His-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human RNF114, His-tagged

Recombinant Human RNF114, His-tagged

RNF114 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : RNF114-31567TH
Product Overview : Recombinant full length protein, corresponding to amino acids 1-228 of Human ZNF313 with N terminal His tag, 33kDa.
Conjugation : HIS
Source : E. coli
Tissue specificity : Expressed in numerous tissues, including skin, CD4 lymphocytes and dendritic cells. Highest levels in testis.
Form : Lyophilised:Reconstitute with 140 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MAAQQRDCGGAAQLAGPAAEADPLGRFTCPVCLEVYEKPV QVPCGHVFCSACLQECLKPKKPVCGVCRSALAPGVRAV ELERQIESTETSCHGCRKNFFLSKIRSHVATCSKYQNYIMEGVKATIKDASLQPRNVPNRYTFPCPYCPEKNFDQEGL VEHCKLFHSTDTKSVVCPICASMPWGDPNYRSANFREH IQRRHRFSYDTFVDYDVDEEDMMNQVLQRSIIDQ
Sequence Similarities : Contains 1 RING-type zinc finger.
Gene Name : RNF114 ring finger protein 114 [ Homo sapiens ]
Official Symbol : RNF114
Synonyms : RNF114; ring finger protein 114; zinc finger protein 313 , ZNF313; RING finger protein 114; PSORS12;
Gene ID : 55905
mRNA Refseq : NM_018683
Protein Refseq : NP_061153
MIM : 612451
Uniprot ID : Q9Y508
Chromosome Location : 20q13
Function : metal ion binding; zinc ion binding;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy