"RNF114" Related Products

Expand

Recombinant Human RNF114, His-tagged

Cat.No.: RNF114-31567TH
Product Overview: Recombinant full length protein, corresponding to amino acids 1-228 of Human ZNF313 with N terminal His tag, 33kDa.
Conjugation: HIS
Source: E. coli
Tissue specificity: Expressed in numerous tissues, including skin, CD4 lymphocytes and dendritic cells. Highest levels in testis.
Form: Lyophilised:Reconstitute with 140 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MAAQQRDCGGAAQLAGPAAEADPLGRFTCPVCLEVYEKPV QVPCGHVFCSACLQECLKPKKPVCGVCRSALAPGVRAV ELERQIESTETSCHGCRKNFFLSKIRSHVATCSKYQNYIMEGVKATIKDASLQPRNVPNRYTFPCPYCPEKNFDQEGL VEHCKLFHSTDTKSVVCPICASMPWGDPNYRSANFREH IQRRHRFSYDTFVDYDVDEEDMMNQVLQRSIIDQ
Sequence Similarities: Contains 1 RING-type zinc finger.
Gene Name: RNF114 ring finger protein 114 [ Homo sapiens ]
Official Symbol: RNF114
Synonyms: RNF114; ring finger protein 114; zinc finger protein 313 , ZNF313; RING finger protein 114; PSORS12;
Gene ID: 55905
mRNA Refseq: NM_018683
Protein Refseq: NP_061153
MIM: 612451
Uniprot ID: Q9Y508
Chromosome Location: 20q13
Function: metal ion binding; zinc ion binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.