Recombinant Human ROBO1

• Cat.No.: ROBO1-30953TH
• Product Overview: Recombinant fragment, corresponding to amino acids 491-589 of Human Robo1, with an N-terminal proprietary tag, predicted MWt 36.52 kDa

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 99 amino acids
• Description: Bilateral symmetric nervous systems have special midline structures that establish a partition between the two mirror image halves. Some axons project toward and across the midline in response to long-range chemoattractants emanating from the midline. The product of this gene is a member of the immunoglobulin gene superfamily and encodes an integral membrane protein that functions in axon guidance and neuronal precursor cell migration. This receptor is activated by SLIT-family proteins, resulting in a repulsive effect on glioma cell guidance in the developing brain. A related gene is located at an adjacent region on chromosome 3. Multiple transcript variants encoding different isoforms have been found for this gene.
• Molecular Weight: 36.520kDa inclusive of tags
• Tissue specificity: Widely expressed, with exception of kidney.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: DGVLVSTQDSRIKQLENGVLQIRYAKLGDTGRYTCIASTPSGEATWSAYIEVQEFGVPVQPPRPTDPNLIPSAPSKPEVTDVSRNTVTLSWQPNLNSGA
• Sequence Similarities: Belongs to the immunoglobulin superfamily. ROBO family.Contains 3 fibronectin type-III domains.Contains 5 Ig-like C2-type (immunoglobulin-like) domains.

Gene Information

• Gene Name: ROBO1 roundabout, axon guidance receptor, homolog 1 (Drosophila) [ Homo sapiens ]
• Official Symbol: ROBO1
• Synonyms: ROBO1; roundabout, axon guidance receptor, homolog 1 (Drosophila); roundabout (axon guidance receptor, Drosophila) homolog 1; roundabout homolog 1; DUTT1; FLJ21882; SAX3
• Gene ID: 6091
• mRNA Refseq: NM_001145845
• Protein Refseq: NP_001139317
• MIM: 602430
• Uniprot ID: Q9Y6N7
• Chromosome Location: 3p12.3
• Pathway: Activation of Rac, organism-specific biosystem; Axon guidance, organism-specific biosystem; Axon guidance, conserved biosystem; Axon guidance, organism-specific biosystem; Developmental Biology, organism-specific biosystem
• Function: LRR domain binding; axon guidance receptor activity; identical protein binding; protein binding; receptor activity