Recombinant Human ROBO1
| Cat.No. : | ROBO1-30953TH | 
| Product Overview : | Recombinant fragment, corresponding to amino acids 491-589 of Human Robo1, with an N-terminal proprietary tag, predicted MWt 36.52 kDa | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | Wheat Germ | 
| Tag : | Non | 
| Protein Length : | 99 amino acids | 
| Description : | Bilateral symmetric nervous systems have special midline structures that establish a partition between the two mirror image halves. Some axons project toward and across the midline in response to long-range chemoattractants emanating from the midline. The product of this gene is a member of the immunoglobulin gene superfamily and encodes an integral membrane protein that functions in axon guidance and neuronal precursor cell migration. This receptor is activated by SLIT-family proteins, resulting in a repulsive effect on glioma cell guidance in the developing brain. A related gene is located at an adjacent region on chromosome 3. Multiple transcript variants encoding different isoforms have been found for this gene. | 
| Molecular Weight : | 36.520kDa inclusive of tags | 
| Tissue specificity : | Widely expressed, with exception of kidney. | 
| Form : | Liquid | 
| Purity : | Proprietary Purification | 
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl | 
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. | 
| Sequences of amino acids : | DGVLVSTQDSRIKQLENGVLQIRYAKLGDTGRYTCIASTPSGEATWSAYIEVQEFGVPVQPPRPTDPNLIPSAPSKPEVTDVSRNTVTLSWQPNLNSGA | 
| Sequence Similarities : | Belongs to the immunoglobulin superfamily. ROBO family.Contains 3 fibronectin type-III domains.Contains 5 Ig-like C2-type (immunoglobulin-like) domains. | 
| Gene Name | ROBO1 roundabout, axon guidance receptor, homolog 1 (Drosophila) [ Homo sapiens ] | 
| Official Symbol | ROBO1 | 
| Synonyms | ROBO1; roundabout, axon guidance receptor, homolog 1 (Drosophila); roundabout (axon guidance receptor, Drosophila) homolog 1; roundabout homolog 1; DUTT1; FLJ21882; SAX3; | 
| Gene ID | 6091 | 
| mRNA Refseq | NM_001145845 | 
| Protein Refseq | NP_001139317 | 
| MIM | 602430 | 
| Uniprot ID | Q9Y6N7 | 
| Chromosome Location | 3p12.3 | 
| Pathway | Activation of Rac, organism-specific biosystem; Axon guidance, organism-specific biosystem; Axon guidance, conserved biosystem; Axon guidance, organism-specific biosystem; Developmental Biology, organism-specific biosystem; | 
| Function | LRR domain binding; axon guidance receptor activity; identical protein binding; protein binding; receptor activity; | 
| ◆ Recombinant Proteins | ||
| ROBO1-1893H | Active Recombinant Human ROBO1 protein, His-tagged | +Inquiry | 
| ROBO1-136H | Recombinant Human ROBO1 Protein, His (Fc)-Avi-tagged | +Inquiry | 
| ROBO1-002H | Recombinant Human roundabout guidance receptor 1 Protein, His tagged | +Inquiry | 
| ROBO1-042H | Active Recombinant Human ROBO1 protein, His-Avi-tagged, Biotinylated | +Inquiry | 
| Robo1-5566M | Recombinant Mouse Robo1 Protein, Myc/DDK-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| ROBO1-2256HCL | Recombinant Human ROBO1 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ROBO1 Products
Required fields are marked with *
My Review for All ROBO1 Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            