Recombinant Human ROBO1

Cat.No. : ROBO1-30953TH
Product Overview : Recombinant fragment, corresponding to amino acids 491-589 of Human Robo1, with an N-terminal proprietary tag, predicted MWt 36.52 kDa
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 99 amino acids
Description : Bilateral symmetric nervous systems have special midline structures that establish a partition between the two mirror image halves. Some axons project toward and across the midline in response to long-range chemoattractants emanating from the midline. The product of this gene is a member of the immunoglobulin gene superfamily and encodes an integral membrane protein that functions in axon guidance and neuronal precursor cell migration. This receptor is activated by SLIT-family proteins, resulting in a repulsive effect on glioma cell guidance in the developing brain. A related gene is located at an adjacent region on chromosome 3. Multiple transcript variants encoding different isoforms have been found for this gene.
Molecular Weight : 36.520kDa inclusive of tags
Tissue specificity : Widely expressed, with exception of kidney.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : DGVLVSTQDSRIKQLENGVLQIRYAKLGDTGRYTCIASTPSGEATWSAYIEVQEFGVPVQPPRPTDPNLIPSAPSKPEVTDVSRNTVTLSWQPNLNSGA
Sequence Similarities : Belongs to the immunoglobulin superfamily. ROBO family.Contains 3 fibronectin type-III domains.Contains 5 Ig-like C2-type (immunoglobulin-like) domains.
Gene Name ROBO1 roundabout, axon guidance receptor, homolog 1 (Drosophila) [ Homo sapiens ]
Official Symbol ROBO1
Synonyms ROBO1; roundabout, axon guidance receptor, homolog 1 (Drosophila); roundabout (axon guidance receptor, Drosophila) homolog 1; roundabout homolog 1; DUTT1; FLJ21882; SAX3;
Gene ID 6091
mRNA Refseq NM_001145845
Protein Refseq NP_001139317
MIM 602430
Uniprot ID Q9Y6N7
Chromosome Location 3p12.3
Pathway Activation of Rac, organism-specific biosystem; Axon guidance, organism-specific biosystem; Axon guidance, conserved biosystem; Axon guidance, organism-specific biosystem; Developmental Biology, organism-specific biosystem;
Function LRR domain binding; axon guidance receptor activity; identical protein binding; protein binding; receptor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ROBO1 Products

Required fields are marked with *

My Review for All ROBO1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon