Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human RPLP2

Cat.No. : RPLP2-29464TH
Product Overview : Recombinant Full Length Human RPLP2 produced in Saccharomyces cerevisiae; amino acids 1-115; , 11.7kDa.
  • Specification
  • Gene Information
  • Related Products
Description : Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal phosphoprotein that is a component of the 60S subunit. The protein, which is a functional equivalent of the E. coli L7/L12 ribosomal protein, belongs to the L12P family of ribosomal proteins. It plays an important role in the elongation step of protein synthesis. Unlike most ribosomal proteins, which are basic, the encoded protein is acidic. Its C-terminal end is nearly identical to the C-terminal ends of the ribosomal phosphoproteins P0 and P1. The P2 protein can interact with P0 and P1 to form a pentameric complex consisting of P1 and P2 dimers, and a P0 monomer. The protein is located in the cytoplasm. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome.
Form : Liquid
Purity : >90% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MRYVASYLLAALGGNSSPSAKDIKKILDSVGIEADDDRLN KVISELNGKNIEDVIAQGIGKLASVPAGGAVAVSAAPGSA APAAGSAPAAAEEKKDEKKEESEESDDDMGFGLFD
Sequence Similarities : Belongs to the ribosomal protein L12P family.
Gene Name : RPLP2 ribosomal protein, large, P2 [ Homo sapiens ]
Official Symbol : RPLP2
Synonyms : RPLP2; ribosomal protein, large, P2; D11S2243E; 60S acidic ribosomal protein P2; acidic ribosomal phosphoprotein P2; LP2; MGC71408; P2; RPP2;
Gene ID : 6181
mRNA Refseq : NM_001004
Protein Refseq : NP_000995
MIM : 180530
Uniprot ID : P05387
Chromosome Location : 11p15.5
Pathway : Cap-dependent Translation Initiation, organism-specific biosystem; Cytoplasmic Ribosomal Proteins, organism-specific biosystem; Developmental Biology, organism-specific biosystem; Diabetes pathways, organism-specific biosystem; Eukaryotic Translation Elongation, organism-specific biosystem;
Function : RNA binding; structural constituent of ribosome;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends