"RUFY3" Related Products

Expand
Expand

Recombinant Human RUFY3, His-tagged

Cat.No.: RUFY3-30763TH
Product Overview: Recombinant fragment, corresponding to amino acids 147-469 of Human RIPX, with N terminal His tag; 323 amino acids, 40kDa.
Description: RIPX (located on chromosome 4) is implicated in the formation of a single axon by developing neurons. May inhibit the formation of additional axons by inhibition of PI3K in minor neuronal processes.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitution with 110 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: TASVKDLPGLKTPVGRGRAWLRLALMQKKLSEYMKALINK KELLSEFYEPNALMMEEEGAIIAGLLVGLNVIDANFCM KGEDLDSQVGVIDFSMYLKDGNSSKGTEGDGQITAILD QKNYVEELNRHLNATVNNLQAKVDALEKSNTKLTEELA VANNRIITLQEEMERVKEESSYILESNRKGPKQDRTAEGQ ALSEARKHLKEETQLRLDVEKELEMQISMRQEMELAMK MLEKDVCEKQDALVSLRQQLDDLRALKHELAFKLQSSD LGVKQKSELNSRLEEKTNQMAATIKQLEQSEKDLVKQA KTLNSAANKLIPKHH
Gene Name: RUFY3 RUN and FYVE domain containing 3 [ Homo sapiens ]
Official Symbol: RUFY3
Synonyms: RUFY3; RUN and FYVE domain containing 3; protein RUFY3; KIAA0871; RIPx; Singar1; single axon related 1;
Gene ID: 22902
mRNA Refseq: NM_014961
Protein Refseq: NP_055776
MIM: 611194
Uniprot ID: Q7L099
Chromosome Location: 4q13.3

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.