Recombinant Human SCGB2A2, His-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human SCGB2A2, His-tagged

Recombinant Human SCGB2A2, His-tagged

SCGB2A2 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : SCGB2A2-29237TH
Product Overview : Recombinant Full length Human Mammaglobin A with an N terminal His tag; 87 amino acids, MWt 9.88kDa.
Description : The mammaglobin gene was first identified using a differential screening approach directed at the isolation of novel, human breast cancer-associated genes.
Protein length : 75 amino acids
Conjugation : HIS
Molecular Weight : 9.880kDa inclusive of tags
Source : E. coli
Tissue specificity : Mammary gland specific. Over-expressed in breast cancer.
Form : Lyophilised:Add deionized water to prepare a working stock solution of approximately 0.5 mg/mL and let the lyophilized pellet dissolve completely. Aliquot reconstituted protein to avoid repeated freezing/thawing cycles and store at –80°C for long term sto
Storage buffer : pH: 7.20Constituents:0.29% Sodium chloride, 0.69% Phosphate Buffer
Storage : Store at -80°C
Sequences of amino acids : MRGSHHHHHHGSGSGCPLLENVISKTINPQVSKTEYKELLQEFIDDNATTNAIDELKECFLNQTDETLSNVEVFMQLIYDSSLCDLF
Sequence Similarities : Belongs to the secretoglobin family. Lipophilin subfamily.
Gene Name : SCGB2A2 secretoglobin, family 2A, member 2 [ Homo sapiens ]
Official Symbol : SCGB2A2
Synonyms : SCGB2A2; secretoglobin, family 2A, member 2; mammaglobin 1 , MGB1; mammaglobin-A; mammaglobin A; MGC71974; UGB2;
Gene ID : 4250
mRNA Refseq : NM_002411
Protein Refseq : NP_002402
MIM : 605562
Uniprot ID : Q13296
Chromosome Location : 11q13
Function : binding; molecular_function; steroid binding;

Online Inquiry


  •  
  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved.