"SCGB2A2" Related Products

Expand

Recombinant Human SCGB2A2, His-tagged

Cat.No.: SCGB2A2-29237TH
Product Overview: Recombinant Full length Human Mammaglobin A with an N terminal His tag; 87 amino acids, MWt 9.88kDa.
Description: The mammaglobin gene was first identified using a differential screening approach directed at the isolation of novel, human breast cancer-associated genes.
Protein length: 75 amino acids
Conjugation: HIS
Molecular Weight: 9.880kDa inclusive of tags
Source: E. coli
Tissue specificity: Mammary gland specific. Over-expressed in breast cancer.
Form: Lyophilised:Add deionized water to prepare a working stock solution of approximately 0.5 mg/mL and let the lyophilized pellet dissolve completely. Aliquot reconstituted protein to avoid repeated freezing/thawing cycles and store at –80°C for long term sto
Storage buffer: pH: 7.20Constituents:0.29% Sodium chloride, 0.69% Phosphate Buffer
Storage: Store at -80°C
Sequences of amino acids: MRGSHHHHHHGSGSGCPLLENVISKTINPQVSKTEYKELLQEFIDDNATTNAIDELKECFLNQTDETLSNVEVFMQLIYDSSLCDLF
Sequence Similarities: Belongs to the secretoglobin family. Lipophilin subfamily.
Gene Name: SCGB2A2 secretoglobin, family 2A, member 2 [ Homo sapiens ]
Official Symbol: SCGB2A2
Synonyms: SCGB2A2; secretoglobin, family 2A, member 2; mammaglobin 1 , MGB1; mammaglobin-A; mammaglobin A; MGC71974; UGB2;
Gene ID: 4250
mRNA Refseq: NM_002411
Protein Refseq: NP_002402
MIM: 605562
Uniprot ID: Q13296
Chromosome Location: 11q13
Function: binding; molecular_function; steroid binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.