Recombinant Human SDHD
Cat.No. : | SDHD-31390TH |
Product Overview : | Recombinant full length Human SDHD with a N terminal proprietary tag: predicted MW 43.56 kDa. |
- Specification
- Gene Information
- Related Products
Description : | Complex II of the respiratory chain, which is specifically involved in the oxidation of succinate, carries electrons from FADH to CoQ.The complex is composed of four nuclear-encoded subunits and is localized in the mitochondrial inner membrane.The subunit D protein is one of two integral membrane proteins anchoring the complex to the matrix side of the membrane.Mutations in SDHD have been linked to hereditary paraganglioma. |
Protein length : | 159 amino acids |
Molecular Weight : | 43.560kDa inclusive of tags |
Source : | Wheat germ |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MAVLWRLSAVCGALGGRALLLRTPVVRPAHISAFLQDRPI PEWCGVQHIHLSPSHHSGSKAASLHWTSERVVSVLLLGLL PAAYLNPCSAMDYSLAAALTLHGHWGLGQVVTDYVHGDAL QKAAKAGLLALSALTFAGLCYFNYHDVGICKAVAMLWKL |
Sequence Similarities : | Belongs to the CybS family. |
Gene Name : | SDHD succinate dehydrogenase complex, subunit D, integral membrane protein [ Homo sapiens ] |
Official Symbol : | SDHD |
Synonyms : | SDHD; succinate dehydrogenase complex, subunit D, integral membrane protein; PGL, PGL1; succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial; |
Gene ID : | 6392 |
mRNA Refseq : | NM_003002 |
Protein Refseq : | NP_002993 |
MIM : | 602690 |
Uniprot ID : | O14521 |
Chromosome Location : | 11q23 |
Pathway : | Alzheimers disease, organism-specific biosystem; Alzheimers disease, conserved biosystem; Citrate cycle (TCA cycle), organism-specific biosystem; Citrate cycle (TCA cycle), conserved biosystem; Citrate cycle, second carbon oxidation, 2-oxoglutarate => |
Function : | electron carrier activity; heme binding; metal ion binding; succinate dehydrogenase activity; ubiquinone binding; |
Products Types
◆ Recombinant Protein | ||
SDHD-3931R | Recombinant Rhesus Macaque SDHD Protein, His (Fc)-Avi-tagged | +Inquiry |
SDHD-7970M | Recombinant Mouse SDHD Protein, His (Fc)-Avi-tagged | +Inquiry |
SDHD-4952R | Recombinant Rat SDHD Protein, His (Fc)-Avi-tagged | +Inquiry |
SDHD-4114R | Recombinant Rhesus monkey SDHD Protein, His-tagged | +Inquiry |
SDHD-14806M | Recombinant Mouse SDHD Protein | +Inquiry |
◆ Lysates | ||
SDHD-2008HCL | Recombinant Human SDHD 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (0)
Ask a questionAsk a Question for All SDHD Products
Required fields are marked with *
My Review for All SDHD Products
Required fields are marked with *
0
Inquiry Basket