"SEPT2" Related Products

Expand

Recombinant Human SEPT2, HIS-tagged

Cat.No.: SEPT2-31400TH
Product Overview: Recombinant full length protein, corresponding to amino acids 1-361 of Human Septin 2 with N terminal His tag. MWt 46kDa;
Description: Septin 2, also known as SEPT2, is a protein which in humans is encoded by the SEPT2 gene.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitution with 98 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MSKQQPTQFINPETPGYVGFANLPNQVHRKSVKKGFEFTL MVVGESGLGKSTLINSLFLTDLYPERVIPGAAEKIERT VQIEASTVEIEERGVKLRLTVVDTPGYGDAINCRDCFK TIISYIDEQFERYLHDESGLNRRHIIDNRVHCCFYFISPF GHGLKPLDVAFMKAIHNKVNIVPVIAKADTLTLKERER LKKRILDEIEEHNIKIYHLPDAESDEDEDFKEQTRLLK ASIPFSVVGSNQLIEAKGKKVRGRLYPWGVVEVENPEH NDFLKLRTMLITHMQDLQEVTQDLHYENFRSERLKRGGRK VENEDMNKDQILLEKEAELRRMQEMIARMQAQMQMQMQ GGDGDGGALGHHV
Gene Name: SEPT2 septin 2 [ Homo sapiens ]
Official Symbol: SEPT2
Synonyms: SEPT2; septin 2; DIFF6, NEDD5, neural precursor cell expressed, developmentally down regulated 5; septin-2; hNedd5; KIAA0158; Pnutl3;
Gene ID: 4735
mRNA Refseq: NM_001008491
Protein Refseq: NP_001008491
MIM: 601506
Uniprot ID: Q15019
Chromosome Location: 2q37.3
Pathway: CDC42 signaling events, organism-specific biosystem;
Function: GTP binding; enzyme regulator activity; nucleotide binding; protein binding; protein complex scaffold;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.