"SERPINA4" Related Products

Expand

Recombinant Human SERPINA4

Cat.No.: SERPINA4-26892TH
Product Overview: Recombinant full length Human Kallistatin with a N terminal proprietary tag: predicted molecular weight 73.04 kDa.
Description: Serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 4, also known as SERPINA4, is a humangene.
Protein length: 427 amino acids
Molecular Weight: 73.040kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Expressed by the liver and secreted in plasma.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MHLIDYLLLLLVGLLALSHGQLHVEHDGESCSNSSHQQIL ETGEGSPSLKIAPANADFAFRFYYLIASETPGKNIFFSPL SISAAYAMLSLGACSHSRSQILEGLGFNLTELSESDVHRG FQHLLHTLNLPGHGLETRVGSALFLSHNLKFLAKFLNDTM AVYEAKLFHTNFYDTVGTIQLINDHVKKETRGKIVDLVSE LKKDVLMVLVNYIYFKALWEKPFISSRTTPKDFYVDENTT VRVPMMLQDQEHHWYLHDRYLPCSVLRMDYKGDATVFFIL PNQGKMREIEEVLTPEMLMRWNNLLRKRNFYKKLELHLPK FSISGSYVLDQILPRLGFTDLFSKWADLSGITKQQKLEAS KSFHKATLDVDEAGTEAAAATSFAIKFFSAQTNRHILRFN RPFLVVIFSTSTQSVLFLGKVVDPTKP
Sequence Similarities: Belongs to the serpin family.
Gene Name: SERPINA4 serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 4 [ Homo sapiens ]
Official Symbol: SERPINA4
Synonyms: SERPINA4; serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 4; PI4, serine (or cysteine) proteinase inhibitor, clade A (alpha 1 antiproteinase, antitrypsin), member 4; kallistatin; KAL; KLST; KST;
Gene ID: 5267
mRNA Refseq: NM_006215
Protein Refseq: NP_006206
MIM: 147935
Uniprot ID: P29622
Chromosome Location: 14q31-q32.1
Function: peptidase inhibitor activity; serine-type endopeptidase inhibitor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.