Recombinant Human SERPINA4 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | SERPINA4-5800H |
Product Overview : | SERPINA4 MS Standard C13 and N15-labeled recombinant protein (NP_006206) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | SERPINA4 (Serpin Family A Member 4) is a Protein Coding gene. Diseases associated with SERPINA4 include Robinow Syndrome, Autosomal Dominant 2 and Ritscher-Schinzel Syndrome 2. Among its related pathways are Response to elevated platelet cytosolic Ca2+. Gene Ontology (GO) annotations related to this gene include serine-type endopeptidase inhibitor activity. An important paralog of this gene is SERPINA3. |
Molecular Mass : | 48.5 kDa |
AA Sequence : | MHLIDYLLLLLVGLLALSHGQLHVEHDGESCSNSSHQQILETGEGSPSLKIAPANADFAFRFYYLIASETPGKNIFFSPLSISAAYAMLSLGACSHSRSQILEGLGFNLTELSESDVHRGFQHLLHTLNLPGHGLETRVGSALFLSHNLKFLAKFLNDTMAVYEAKLFHTNFYDTVGTIQLINDHVKKETRGKIVDLVSELKKDVLMVLVNYIYFKALWEKPFISSRTTPKDFYVDENTTVRVPMMLQDQEHHWYLHDRYLPCSVLRMDYKGDATVFFILPNQGKMREIEEVLTPEMLMRWNNLLRKRNFYKKLELHLPKFSISGSYVLDQILPRLGFTDLFSKWADLSGITKQQKLEASKSFHKATLDVDEAGTEAAAATSFAIKFFSAQTNRHILRFNRPFLVVIFSTSTQSVLFLGKVVDPTKPSGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | SERPINA4 serpin family A member 4 [ Homo sapiens (human) ] |
Official Symbol | SERPINA4 |
Synonyms | KAL; KST; PI4; KLST; PI-4; kallistatin |
Gene ID | 5267 |
mRNA Refseq | NM_006215 |
Protein Refseq | NP_006206 |
MIM | 147935 |
UniProt ID | P29622 |
◆ Recombinant Proteins | ||
SERPINA4-5800H | Recombinant Human SERPINA4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SERPINA4-1974H | Recombinant Human SERPINA4 Protein, His (Fc)-Avi-tagged | +Inquiry |
SERPINA4-5911H | Recombinant Human SERPINA4 Protein (Gln21-Pro427), C-His tagged | +Inquiry |
SERPINA4-4885C | Recombinant Chicken SERPINA4 | +Inquiry |
SERPINA4-2178HFL | Recombinant Full Length Human SERPINA4 Protein, C-Flag-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SERPINA4 Products
Required fields are marked with *
My Review for All SERPINA4 Products
Required fields are marked with *
0
Inquiry Basket