"SGSH" Related Products

Expand

Recombinant Human SGSH

Cat.No.: SGSH-30971TH
Product Overview: Recombinant full length Human SGSH with proprietary N terminal tag; Predicted MW 81.29 kDa.
Description: This gene encodes one of several enzymes involved in the lysosomal degradation of heparan sulfate. Mutations in this gene are associated with Sanfilippo syndrome A, one type of the lysosomal storage disease mucopolysaccaridosis III, which results from impaired degradation of heparan sulfate. Transcripts of varying sizes have been reported but their biological validity has not been determined.
Protein length: 502 amino acids
Molecular Weight: 81.290kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MSCPVPACCALLLVLGLCRARPRNALLLLADDGGFESGAY NNSAIATPHLDALARRSLLFRNAFTSVSSCSPSRASLLTG LPQHQNGMYGLHQDVHHFNSFDKVRSLPLLLSQAGVRTGI IGKKHVGPETVYPFDFAYTEENGSVLQVGRNITRIKLLVR KFLQTQDDRPFFLYVAFHDPHRCGHSQPQYGTFCEKFGNG ESGMGRIPDWTPQAYDPLDVLVPYFVPNTPAARADLAAQY TTVGRMDQGVGLVLQELRDAGVLNDTLVIFTSDNGIPFPS GRTNLYWPGTAEPLLVSSPEHPKRWGQVSEAYVSLLDLTP TILDWFSIPYPSYAIFGSKTIHLTGRSLLPALEAEPLWAT VFGSQSHHEVTMSYPMRSVQHRHFRLVHNLNFKMPFPIDQ DFYVSPTFQDLLNRTTAGQPTGWYKDLRHYYYRARWELYD RSRDPHETQNLATDPRFAQLLEMLRDQLAKWQWETHDPWV CAPDGVLEEKLSPQCQPLHNEL
Sequence Similarities: Belongs to the sulfatase family.
Gene Name: SGSH N-sulfoglucosamine sulfohydrolase [ Homo sapiens ]
Official Symbol: SGSH
Synonyms: SGSH; N-sulfoglucosamine sulfohydrolase; N-sulphoglucosamine sulphohydrolase; HSS; MPS3A; mucopolysaccharidosis type IIIA; SFMD; sulfamidase;
Gene ID: 6448
mRNA Refseq: NM_000199
Protein Refseq: NP_000190
MIM: 605270
Uniprot ID: P51688
Chromosome Location: 17q25.3
Pathway: Glycosaminoglycan degradation, organism-specific biosystem; Glycosaminoglycan degradation, conserved biosystem; Heparan sulfate degradation, organism-specific biosystem; Heparan sulfate degradation, conserved biosystem; Lysosome, organism-specific biosystem;
Function: N-sulfoglucosamine sulfohydrolase activity; catalytic activity; hydrolase activity; metal ion binding; sulfuric ester hydrolase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.