"SH3BGRL" Related Products

Expand
Expand

Recombinant Human SH3BGRL

Cat.No.: SH3BGRL-30811TH
Product Overview: Recombinant full length Human SH3BGRL with N-terminal proprietary tag. Predicted MW 38.65kDa.
Description: SH3 domain-binding glutamic acid-rich-like protein is a protein that in humans is encoded by the SH3BGRL gene.
Protein length: 114 amino acids
Molecular Weight: 38.650kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Ubiquitous.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MVIRVYIASSSGSTAIKKKQQDVLGFLEANKIGFEEKDIA ANEENRKWMRENVPENSRPATGYPLPPQIFNESQYRGDYD AFFEARENNAVYAFLGLTAPPGSKEAEVQAKQQA
Sequence Similarities: Belongs to the SH3BGR family.
Gene Name: SH3BGRL SH3 domain binding glutamic acid-rich protein like [ Homo sapiens ]
Official Symbol: SH3BGRL
Synonyms: SH3BGRL; SH3 domain binding glutamic acid-rich protein like; SH3 domain-binding glutamic acid-rich-like protein; MGC117402;
Gene ID: 6451
mRNA Refseq: NM_003022
Protein Refseq: NP_003013
MIM: 300190
Uniprot ID: O75368
Chromosome Location: Xq13.3
Pathway: EGFR1 Signaling Pathway, organism-specific biosystem;
Function: SH3 domain binding; SH3/SH2 adaptor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.