"SHOX2" Related Products

Expand
Expand

Recombinant Human SHOX2

Cat.No.: SHOX2-31358TH
Product Overview: Recombinant fragment corresponding to amino acids 117-204 of Human SHOX2 with proprietary tag; Predicted MWt 35.31 kDa.
Description: This gene is a member of the homeobox family of genes that encode proteins containing a 60-amino acid residue motif that represents a DNA binding domain. Homeobox genes have been characterized extensively as transcriptional regulators involved in pattern formation in both invertebrate and vertebrate species. Several human genetic disorders are caused by aberrations in human homeobox genes. This locus represents a pseudoautosomal homeobox gene that is thought to be responsible for idiopathic short stature, and it is implicated in the short stature phenotype of Turner syndrome patients. This gene is considered to be a candidate gene for Cornelia de Lange syndrome. Alternative splicing results in multiple transcript variants.
Protein length: 88 amino acids
Molecular Weight: 35.310kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Expressed in heart, skeletal muscle, liver, lung, bone marrow fibroblast, pancreas and placenta.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.31% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: SPELKDRKDDAKGMEDEGQTKIKQRRSRTNFTLEQLNELERLFDETHYPDAFMREELSQRLGLSEARVQVWFQNRRAKCRKQENQLHK
Sequence Similarities: Belongs to the paired homeobox family. Bicoid subfamily.Contains 1 homeobox DNA-binding domain.
Gene Name: SHOX2 short stature homeobox 2 [ Homo sapiens ]
Official Symbol: SHOX2
Synonyms: SHOX2; short stature homeobox 2; short stature homeobox protein 2; OG12; OG12X; SHOT;
Gene ID: 6474
mRNA Refseq: NM_001163678
Protein Refseq: NP_001157150
MIM: 602504
Uniprot ID: O60902
Chromosome Location: 3q25.32
Function: transcription regulatory region sequence-specific DNA binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.