Recombinant Human SKIL

Cat.No. : SKIL-27724TH
Product Overview : Recombinant fragment of Human SnoN with a N terminal proprietary tag: predicted molecular weight 34.21 kDa inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 78 amino acids
Description : The protein encoded by this gene is a component of the SMAD pathway, which regulates cell growth and differentiation through transforming growth factor-beta (TGFB). In the absence of ligand, the encoded protein binds to the promoter region of TGFB-responsive genes and recruits a nuclear repressor complex. TGFB signaling causes SMAD3 to enter the nucleus and degrade this protein, allowing these genes to be activated. Four transcript variants encoding three different isoforms have been found for this gene.
Molecular Weight : 34.210kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : PRTFPQNGSVLPAKSSLAQLKETGSAFEVEHECLGKCQGLFAPQFYVQPDAPCIQCLECCGMFAPQTFVMHSHRSPDK
Gene Name SKIL SKI-like oncogene [ Homo sapiens ]
Official Symbol SKIL
Synonyms SKIL; SKI-like oncogene; ski-like protein; SNO; SnoA; SnoN;
Gene ID 6498
mRNA Refseq NM_001145098
Protein Refseq NP_001138570
MIM 165340
Uniprot ID P12757
Chromosome Location 3q26
Pathway Regulation of nuclear SMAD2/3 signaling, organism-specific biosystem; TGF Beta Signaling Pathway, organism-specific biosystem; TGF-beta Receptor Signaling Pathway, organism-specific biosystem; TGF-beta receptor signaling, organism-specific biosystem;
Function NOT DNA binding; SMAD binding; chromatin binding; chromatin binding; nucleotide binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SKIL Products

Required fields are marked with *

My Review for All SKIL Products

Required fields are marked with *

0
cart-icon
0
compare icon