"SLC20A2" Related Products

Expand
Expand

Recombinant Human SLC20A2

Cat.No.: SLC20A2-31411TH
Product Overview: Recombinant fragment of Human SLC20A2 with N-terminal proprietary tag. Predicted MW 36.63kDa.
Description: Sodium-dependent phosphate transporter 2 is a protein that in humans is encoded by the SLC20A2 gene.
Protein length: 100 amino acids
Molecular Weight: 36.630kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Ubiquitously expressed.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: TGKLQKEGALSRVSDESLSKVQEAESPVFKELPGAKANDDSTIPLTGAAGETLGTSEGTSAGSHPRAAYGRALSMTHGSVKSPISNGTFGFDGHTRSDGH
Sequence Similarities: Belongs to the inorganic phosphate transporter (PiT) (TC 2.A.20) family.
Gene Name: SLC20A2 solute carrier family 20 (phosphate transporter), member 2 [ Homo sapiens ]
Official Symbol: SLC20A2
Synonyms: SLC20A2; solute carrier family 20 (phosphate transporter), member 2; GLVR2, MLVAR; sodium-dependent phosphate transporter 2; Glvr 2; PiT 2;
Gene ID: 6575
mRNA Refseq: NM_006749
Protein Refseq: NP_006740
MIM: 158378
Uniprot ID: Q08357
Chromosome Location: 8p12-p11
Pathway: SLC-mediated transmembrane transport, organism-specific biosystem; Sodium-coupled phosphate cotransporters, organism-specific biosystem; Transmembrane transport of small molecules, organism-specific biosystem; Transport of inorganic cations/anions and amino acids/oligopeptides, organism-specific biosystem;
Function: inorganic phosphate transmembrane transporter activity; receptor activity; sodium:phosphate symporter activity; symporter activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.