Recombinant Human SLC20A2

Cat.No. : SLC20A2-31411TH
Product Overview : Recombinant fragment of Human SLC20A2 with N-terminal proprietary tag. Predicted MW 36.63kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 100 amino acids
Description : Sodium-dependent phosphate transporter 2 is a protein that in humans is encoded by the SLC20A2 gene.
Molecular Weight : 36.630kDa inclusive of tags
Tissue specificity : Ubiquitously expressed.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : TGKLQKEGALSRVSDESLSKVQEAESPVFKELPGAKANDDSTIPLTGAAGETLGTSEGTSAGSHPRAAYGRALSMTHGSVKSPISNGTFGFDGHTRSDGH
Sequence Similarities : Belongs to the inorganic phosphate transporter (PiT) (TC 2.A.20) family.
Gene Name SLC20A2 solute carrier family 20 (phosphate transporter), member 2 [ Homo sapiens ]
Official Symbol SLC20A2
Synonyms SLC20A2; solute carrier family 20 (phosphate transporter), member 2; GLVR2, MLVAR; sodium-dependent phosphate transporter 2; Glvr 2; PiT 2;
Gene ID 6575
mRNA Refseq NM_006749
Protein Refseq NP_006740
MIM 158378
Uniprot ID Q08357
Chromosome Location 8p12-p11
Pathway SLC-mediated transmembrane transport, organism-specific biosystem; Sodium-coupled phosphate cotransporters, organism-specific biosystem; Transmembrane transport of small molecules, organism-specific biosystem; Transport of inorganic cations/anions and amino acids/oligopeptides, organism-specific biosystem;
Function inorganic phosphate transmembrane transporter activity; receptor activity; sodium:phosphate symporter activity; symporter activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SLC20A2 Products

Required fields are marked with *

My Review for All SLC20A2 Products

Required fields are marked with *

0
cart-icon