Recombinant Human SLC20A2
Cat.No. : | SLC20A2-31411TH |
Product Overview : | Recombinant fragment of Human SLC20A2 with N-terminal proprietary tag. Predicted MW 36.63kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 100 amino acids |
Description : | Sodium-dependent phosphate transporter 2 is a protein that in humans is encoded by the SLC20A2 gene. |
Molecular Weight : | 36.630kDa inclusive of tags |
Tissue specificity : | Ubiquitously expressed. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | TGKLQKEGALSRVSDESLSKVQEAESPVFKELPGAKANDDSTIPLTGAAGETLGTSEGTSAGSHPRAAYGRALSMTHGSVKSPISNGTFGFDGHTRSDGH |
Sequence Similarities : | Belongs to the inorganic phosphate transporter (PiT) (TC 2.A.20) family. |
Gene Name | SLC20A2 solute carrier family 20 (phosphate transporter), member 2 [ Homo sapiens ] |
Official Symbol | SLC20A2 |
Synonyms | SLC20A2; solute carrier family 20 (phosphate transporter), member 2; GLVR2, MLVAR; sodium-dependent phosphate transporter 2; Glvr 2; PiT 2; |
Gene ID | 6575 |
mRNA Refseq | NM_006749 |
Protein Refseq | NP_006740 |
MIM | 158378 |
Uniprot ID | Q08357 |
Chromosome Location | 8p12-p11 |
Pathway | SLC-mediated transmembrane transport, organism-specific biosystem; Sodium-coupled phosphate cotransporters, organism-specific biosystem; Transmembrane transport of small molecules, organism-specific biosystem; Transport of inorganic cations/anions and amino acids/oligopeptides, organism-specific biosystem; |
Function | inorganic phosphate transmembrane transporter activity; receptor activity; sodium:phosphate symporter activity; symporter activity; |
◆ Recombinant Proteins | ||
SLC20A2-5449R | Recombinant Rat SLC20A2 Protein | +Inquiry |
SLC20A2-1217H | Recombinant Human SLC20A2 Protein (A2-V652), 8×His-MBP, Flag tagged | +Inquiry |
SLC20A2-4049R | Recombinant Rhesus Macaque SLC20A2 Protein, His (Fc)-Avi-tagged | +Inquiry |
SLC20A2-4759Z | Recombinant Zebrafish SLC20A2 | +Inquiry |
SLC20A2-2805C | Recombinant Chicken SLC20A2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLC20A2-1620HCL | Recombinant Human SLC20A2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLC20A2 Products
Required fields are marked with *
My Review for All SLC20A2 Products
Required fields are marked with *