Recombinant Human SLC20A2

• Cat.No.: SLC20A2-31411TH
• Product Overview: Recombinant fragment of Human SLC20A2 with N-terminal proprietary tag. Predicted MW 36.63kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 100 amino acids
• Description: Sodium-dependent phosphate transporter 2 is a protein that in humans is encoded by the SLC20A2 gene.
• Molecular Weight: 36.630kDa inclusive of tags
• Tissue specificity: Ubiquitously expressed.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: TGKLQKEGALSRVSDESLSKVQEAESPVFKELPGAKANDDSTIPLTGAAGETLGTSEGTSAGSHPRAAYGRALSMTHGSVKSPISNGTFGFDGHTRSDGH
• Sequence Similarities: Belongs to the inorganic phosphate transporter (PiT) (TC 2.A.20) family.

Gene Information

• Gene Name: SLC20A2 solute carrier family 20 (phosphate transporter), member 2 [ Homo sapiens ]
• Official Symbol: SLC20A2
• Synonyms: SLC20A2; solute carrier family 20 (phosphate transporter), member 2; GLVR2, MLVAR; sodium-dependent phosphate transporter 2; Glvr 2; PiT 2
• Gene ID: 6575
• mRNA Refseq: NM_006749
• Protein Refseq: NP_006740
• MIM: 158378
• Uniprot ID: Q08357
• Chromosome Location: 8p12-p11
• Pathway: SLC-mediated transmembrane transport, organism-specific biosystem; Sodium-coupled phosphate cotransporters, organism-specific biosystem; Transmembrane transport of small molecules, organism-specific biosystem; Transport of inorganic cations/anions and amino acids/oligopeptides, organism-specific biosystem
• Function: inorganic phosphate transmembrane transporter activity; receptor activity; sodium:phosphate symporter activity; symporter activity