"SLC22A3" Related Products

Recombinant Human SLC22A3

Cat.No.: SLC22A3-31412TH
Product Overview: Recombinant fragment of Human SLC22A3 with N terminal proprietary tag; Predicted MW 32.89 kDa.
Description: Polyspecific organic cation transporters in the liver, kidney, intestine, and other organs are critical for elimination of many endogenous small organic cations as well as a wide array of drugs and environmental toxins. This gene is one of three similar cation transporter genes located in a cluster on chromosome 6. The encoded protein contains twelve putative transmembrane domains and is a plasma integral membrane protein.
Protein length: 66 amino acids
Molecular Weight: 32.890kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Expressed in placenta, skeletal muscle, prostate, aorta, liver, fetal lung, salivary gland, adrenal gland, kidney and brain cortex. No expression detected in spleen.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: CQRYLLEAANDSASATSALSCADPLAAFPNRSAPLVPCRGGWRYAQAHSTIVSEFDLVCVNAWMLD
Sequence Similarities: Belongs to the major facilitator superfamily. Organic cation transporter family.
Gene Name: SLC22A3 solute carrier family 22 (extraneuronal monoamine transporter), member 3 [ Homo sapiens ]
Official Symbol: SLC22A3
Synonyms: SLC22A3; solute carrier family 22 (extraneuronal monoamine transporter), member 3; solute carrier family 22 member 3; EMT; OCT3;
Gene ID: 6581
mRNA Refseq: NM_021977
Protein Refseq: NP_068812
MIM: 604842
Uniprot ID: O75751
Chromosome Location: 6q25.3
Pathway: Organic cation transport, organism-specific biosystem; Organic cation/anion/zwitterion transport, organism-specific biosystem; SLC-mediated transmembrane transport, organism-specific biosystem; Transmembrane transport of small molecules, organism-specific biosystem; Transport of glucose and other sugars, bile salts and organic acids, metal ions and amine compounds, organism-specific biosystem;
Function: dopamine transmembrane transporter activity; ion transmembrane transporter activity; organic cation transmembrane transporter activity; protein binding; quaternary ammonium group transmembrane transporter activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.