Recombinant Human SLC22A3

Cat.No. : SLC22A3-31412TH
Product Overview : Recombinant fragment of Human SLC22A3 with N terminal proprietary tag; Predicted MW 32.89 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 66 amino acids
Description : Polyspecific organic cation transporters in the liver, kidney, intestine, and other organs are critical for elimination of many endogenous small organic cations as well as a wide array of drugs and environmental toxins. This gene is one of three similar cation transporter genes located in a cluster on chromosome 6. The encoded protein contains twelve putative transmembrane domains and is a plasma integral membrane protein.
Molecular Weight : 32.890kDa inclusive of tags
Tissue specificity : Expressed in placenta, skeletal muscle, prostate, aorta, liver, fetal lung, salivary gland, adrenal gland, kidney and brain cortex. No expression detected in spleen.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : CQRYLLEAANDSASATSALSCADPLAAFPNRSAPLVPCRGGWRYAQAHSTIVSEFDLVCVNAWMLD
Sequence Similarities : Belongs to the major facilitator superfamily. Organic cation transporter family.
Gene Name SLC22A3 solute carrier family 22 (extraneuronal monoamine transporter), member 3 [ Homo sapiens ]
Official Symbol SLC22A3
Synonyms SLC22A3; solute carrier family 22 (extraneuronal monoamine transporter), member 3; solute carrier family 22 member 3; EMT; OCT3;
Gene ID 6581
mRNA Refseq NM_021977
Protein Refseq NP_068812
MIM 604842
Uniprot ID O75751
Chromosome Location 6q25.3
Pathway Organic cation transport, organism-specific biosystem; Organic cation/anion/zwitterion transport, organism-specific biosystem; SLC-mediated transmembrane transport, organism-specific biosystem; Transmembrane transport of small molecules, organism-specific biosystem; Transport of glucose and other sugars, bile salts and organic acids, metal ions and amine compounds, organism-specific biosystem;
Function dopamine transmembrane transporter activity; ion transmembrane transporter activity; organic cation transmembrane transporter activity; protein binding; quaternary ammonium group transmembrane transporter activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SLC22A3 Products

Required fields are marked with *

My Review for All SLC22A3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon