Recombinant Human SLC22A3

• Cat.No.: SLC22A3-31412TH
• Product Overview: Recombinant fragment of Human SLC22A3 with N terminal proprietary tag; Predicted MW 32.89 kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 66 amino acids
• Description: Polyspecific organic cation transporters in the liver, kidney, intestine, and other organs are critical for elimination of many endogenous small organic cations as well as a wide array of drugs and environmental toxins. This gene is one of three similar cation transporter genes located in a cluster on chromosome 6. The encoded protein contains twelve putative transmembrane domains and is a plasma integral membrane protein.
• Molecular Weight: 32.890kDa inclusive of tags
• Tissue specificity: Expressed in placenta, skeletal muscle, prostate, aorta, liver, fetal lung, salivary gland, adrenal gland, kidney and brain cortex. No expression detected in spleen.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: CQRYLLEAANDSASATSALSCADPLAAFPNRSAPLVPCRGGWRYAQAHSTIVSEFDLVCVNAWMLD
• Sequence Similarities: Belongs to the major facilitator superfamily. Organic cation transporter family.

Gene Information

• Gene Name: SLC22A3 solute carrier family 22 (extraneuronal monoamine transporter), member 3 [ Homo sapiens ]
• Official Symbol: SLC22A3
• Synonyms: SLC22A3; solute carrier family 22 (extraneuronal monoamine transporter), member 3; solute carrier family 22 member 3; EMT; OCT3
• Gene ID: 6581
• mRNA Refseq: NM_021977
• Protein Refseq: NP_068812
• MIM: 604842
• Uniprot ID: O75751
• Chromosome Location: 6q25.3
• Pathway: Organic cation transport, organism-specific biosystem; Organic cation/anion/zwitterion transport, organism-specific biosystem; SLC-mediated transmembrane transport, organism-specific biosystem; Transmembrane transport of small molecules, organism-specific biosystem; Transport of glucose and other sugars, bile salts and organic acids, metal ions and amine compounds, organism-specific biosystem
• Function: dopamine transmembrane transporter activity; ion transmembrane transporter activity; organic cation transmembrane transporter activity; protein binding; quaternary ammonium group transmembrane transporter activity