"SLC5A2" Related Products

Recombinant Human SLC5A2

Cat.No.: SLC5A2-30972TH
Product Overview: Recombinant fragment of Human SGLT2 with a N terminal proprietary tag: predicted molecular weight 31.13 kDa inclusive of tag.
Description: This gene encodes a member of the sodium glucose cotransporter family which are sodium-dependent glucose transport proteins. The encoded protein is the major cotransporter involved in glucose reabsorption in the kidney. Mutations in this gene are associated with renal glucosuria.
Protein length: 50 amino acids
Molecular Weight: 31.130kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: GLFDKYLGAATSLTVSEDPAVGNISSFCYRPRPDSYHLLRHPVTGDLPWP
Sequence Similarities: Belongs to the sodium:solute symporter (SSF) (TC 2.A.21) family.
Gene Name: SLC5A2 solute carrier family 5 (sodium/glucose cotransporter), member 2 [ Homo sapiens ]
Official Symbol: SLC5A2
Synonyms: SLC5A2; solute carrier family 5 (sodium/glucose cotransporter), member 2; SGLT2; sodium/glucose cotransporter 2;
Gene ID: 6524
mRNA Refseq: NM_003041
Protein Refseq: NP_003032
MIM: 182381
Uniprot ID: P31639
Chromosome Location: 16p12-p11
Pathway: Na+-dependent glucose transporters, organism-specific biosystem; SLC-mediated transmembrane transport, organism-specific biosystem; Transmembrane transport of small molecules, organism-specific biosystem; Transport of glucose and other sugars, bile salts and organic acids, metal ions and amine compounds, organism-specific biosystem;
Function: low-affinity glucose:sodium symporter activity; symporter activity; transporter activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.