Recombinant Human SLC5A2

Cat.No. : SLC5A2-30972TH
Product Overview : Recombinant fragment of Human SGLT2 with a N terminal proprietary tag: predicted molecular weight 31.13 kDa inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 50 amino acids
Description : This gene encodes a member of the sodium glucose cotransporter family which are sodium-dependent glucose transport proteins. The encoded protein is the major cotransporter involved in glucose reabsorption in the kidney. Mutations in this gene are associated with renal glucosuria.
Molecular Weight : 31.130kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : GLFDKYLGAATSLTVSEDPAVGNISSFCYRPRPDSYHLLRHPVTGDLPWP
Sequence Similarities : Belongs to the sodium:solute symporter (SSF) (TC 2.A.21) family.
Gene Name SLC5A2 solute carrier family 5 (sodium/glucose cotransporter), member 2 [ Homo sapiens ]
Official Symbol SLC5A2
Synonyms SLC5A2; solute carrier family 5 (sodium/glucose cotransporter), member 2; SGLT2; sodium/glucose cotransporter 2;
Gene ID 6524
mRNA Refseq NM_003041
Protein Refseq NP_003032
MIM 182381
Uniprot ID P31639
Chromosome Location 16p12-p11
Pathway Na+-dependent glucose transporters, organism-specific biosystem; SLC-mediated transmembrane transport, organism-specific biosystem; Transmembrane transport of small molecules, organism-specific biosystem; Transport of glucose and other sugars, bile salts and organic acids, metal ions and amine compounds, organism-specific biosystem;
Function low-affinity glucose:sodium symporter activity; symporter activity; transporter activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SLC5A2 Products

Required fields are marked with *

My Review for All SLC5A2 Products

Required fields are marked with *

0
cart-icon
0
compare icon