Recombinant Human SLC5A2 Protein (1-102 aa), His-Myc-tagged

• Cat.No.: SLC5A2-2210H
• Product Overview: Recombinant Human SLC5A2 Protein (1-102 aa) is produced by E. coli expression system. This protein is fused with a 10xHis tag at the N-terminal and a Myc tag at the C-terminal. Research Area: Signal Transduction. Protein Description: Partial.

Specification

• Species: Human
• Source: E.coli
• Tag: His&Myc
• Protein Length: 1-102 aa
• Description: Sodium-dependent glucose transporter. Has a Na+ to glucose coupling ratio of 1:1. Efficient substrate transport in mammalian kidney is provided by the concerted action of a low affinity high capacity and a high affinity low capacity Na+/glucose cotransporter arranged in series along kidney proximal tubules.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 15.5 kDa
• AA Sequence: MEEHTEAGSAPEMGAQKALIDNPADILVIAAYFLLVIGVGLWSMCRTNRGTVGGYFLAGRSMVWWPVGASLFASNIGSGHFVGLAGTGAASGLAVAGFEWNA
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: SLC5A2 solute carrier family 5 (sodium/glucose cotransporter), member 2 [ Homo sapiens ]
• Official Symbol: SLC5A2
• Synonyms: SLC5A2; SGLT2; sodium/glucose cotransporter 2; Na(+)/glucose cotransporter 2
• Gene ID: 6524
• mRNA Refseq: NM_003041
• Protein Refseq: NP_003032
• MIM: 182381
• UniProt ID: P31639