Recombinant Human SLC5A2 Protein (1-102 aa), His-Myc-tagged
Cat.No. : | SLC5A2-2210H |
Product Overview : | Recombinant Human SLC5A2 Protein (1-102 aa) is produced by E. coli expression system. This protein is fused with a 10xHis tag at the N-terminal and a Myc tag at the C-terminal. Research Area: Signal Transduction. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 1-102 aa |
Description : | Sodium-dependent glucose transporter. Has a Na+ to glucose coupling ratio of 1:1. Efficient substrate transport in mammalian kidney is provided by the concerted action of a low affinity high capacity and a high affinity low capacity Na+/glucose cotransporter arranged in series along kidney proximal tubules. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 15.5 kDa |
AA Sequence : | MEEHTEAGSAPEMGAQKALIDNPADILVIAAYFLLVIGVGLWSMCRTNRGTVGGYFLAGRSMVWWPVGASLFASNIGSGHFVGLAGTGAASGLAVAGFEWNA |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | SLC5A2 solute carrier family 5 (sodium/glucose cotransporter), member 2 [ Homo sapiens ] |
Official Symbol | SLC5A2 |
Synonyms | SLC5A2; SGLT2; sodium/glucose cotransporter 2; Na(+)/glucose cotransporter 2; |
Gene ID | 6524 |
mRNA Refseq | NM_003041 |
Protein Refseq | NP_003032 |
MIM | 182381 |
UniProt ID | P31639 |
◆ Recombinant Proteins | ||
SLC5A2-2396H | Recombinant Human SLC5A2 Transmembrane protein, His-SUMO & Myc-tagged | +Inquiry |
Slc5a2-2078R | Recombinant Rat Slc5a2 Protein, His-tagged | +Inquiry |
SLC5A2-2210H | Recombinant Human SLC5A2 Protein (1-102 aa), His-Myc-tagged | +Inquiry |
SLC5A2-15482M | Recombinant Mouse SLC5A2 Protein | +Inquiry |
SLC5A2-8399M | Recombinant Mouse SLC5A2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLC5A2-1709HCL | Recombinant Human SLC5A2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SLC5A2 Products
Required fields are marked with *
My Review for All SLC5A2 Products
Required fields are marked with *
0
Inquiry Basket