Recombinant Human SNAI1
Cat.No. : | SNAI1-30016TH |
Product Overview : | Recombinant fragment corresponding to amino acids 121-230 of Human SNAIL with a N terminal proprietary tag; predicted MWt 37.73 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
Description : | The Drosophila embryonic protein snail is a zinc finger transcriptional repressor which downregulates the expression of ectodermal genes within the mesoderm. The nuclear protein encoded by this gene is structurally similar to the Drosophila snail protein, and is also thought to be critical for mesoderm formation in the developing embryo. At least two variants of a similar processed pseudogene have been found on chromosome 2. |
Protein length : | 110 amino acids |
Molecular Weight : | 37.730kDa inclusive of tags |
Source : | Wheat germ |
Tissue specificity : | Expressed in a variety of tissues with the highest expression in kidney. Expressed in mesenchymal and epithelial cell lines. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | LEAEAYAAFPGLGQVPKQLAQLSEAKDLQARKAFNCKYCN KEYLSLGALKMHIRSHTLPCVCGTCGKAFSRPWLLQGHVR THTGEKPFSCPHCSRAFADRSNLRAHLQTH |
Sequence Similarities : | Belongs to the snail C2H2-type zinc-finger protein family.Contains 4 C2H2-type zinc fingers. |
Gene Name : | SNAI1 snail homolog 1 (Drosophila) [ Homo sapiens ] |
Official Symbol : | SNAI1 |
Synonyms : | SNAI1; snail homolog 1 (Drosophila); snail 1 (drosophila homolog), zinc finger protein; zinc finger protein SNAI1; SLUGH2; SNA; SNAH; SNAIL; SNAIL1; |
Gene ID : | 6615 |
mRNA Refseq : | NM_005985 |
Protein Refseq : | NP_005976 |
MIM : | 604238 |
Uniprot ID : | O95863 |
Chromosome Location : | 20q13.2 |
Pathway : | Adherens junction, organism-specific biosystem; Adherens junction, conserved biosystem; Signaling events mediated by Hepatocyte Growth Factor Receptor (c-Met), organism-specific biosystem; Validated targets of C-MYC transcriptional activation, organism-specific biosystem; |
Function : | kinase binding; metal ion binding; protein binding; sequence-specific DNA binding; zinc ion binding; |
Products Types
◆ Recombinant Protein | ||
Snai1-5989M | Recombinant Mouse Snai1 Protein, Myc/DDK-tagged | +Inquiry |
SNAI1-8511M | Recombinant Mouse SNAI1 Protein, His (Fc)-Avi-tagged | +Inquiry |
SNAI1-330H | Recombinant Human snail family zinc finger 1, His-tagged | +Inquiry |
SNAI1-6699C | Recombinant Chicken SNAI1 | +Inquiry |
SNAI1-178H | Recombinant Human SNAI1 protein, T7/His-tagged | +Inquiry |
◆ Lysates | ||
SNAI1-1643HCL | Recombinant Human SNAI1 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket