"SRSF4" Related Products

Recombinant Human SRSF4

Cat.No.: SRSF4-26856TH
Product Overview: Recombinant fragment of Human SFRS4 with N-terminal proprietary tag. Predicted MW 34.10 kDa.
Description: This gene encodes a member of the arginine/serine-rich splicing factor family. The encoded protein likely functions in mRNA processing.
Protein length: 77 amino acids
Molecular Weight: 34.100kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: PPTRTEYRLIVENLSSRCSWQDLKDYMRQAGEVTYADAHKGRKNEGVIEFVSYSDMKRALEKLDGTEVNGRKIRLVE
Sequence Similarities: Belongs to the splicing factor SR family.Contains 2 RRM (RNA recognition motif) domains.
Gene Name: SRSF4 serine/arginine-rich splicing factor 4 [ Homo sapiens ]
Official Symbol: SRSF4
Synonyms: SRSF4; serine/arginine-rich splicing factor 4; SFRS4, splicing factor, arginine/serine rich 4; SR splicing factor 4; SRP75;
Gene ID: 6429
mRNA Refseq: NM_005626
Protein Refseq: NP_005617
MIM: 601940
Uniprot ID: Q08170
Chromosome Location: 1p35.3
Pathway: Cleavage of Growing Transcript in the Termination Region, organism-specific biosystem; Formation and Maturation of mRNA Transcript, organism-specific biosystem; Gene Expression, organism-specific biosystem; Herpes simplex infection, organism-specific biosystem; Herpes simplex infection, conserved biosystem;
Function: RNA binding; nucleotide binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.