"SSBP1" Related Products

Expand
Expand

Recombinant Human SSBP1

Cat.No.: SSBP1-29275TH
Product Overview: Recombinant full length Human SSBP1 with proprietary tag; Predicted MWt 41.69 kDa.
Description: SSBP1 is a housekeeping gene involved in mitochondrial biogenesis (Tiranti et al.
Protein length: 148 amino acids
Molecular Weight: 41.690kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.31% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MFRRPVLQVLRQFVRHESETTTSLVLERSLNRVHLLGRVGQDPVLRQVEGKNPVTIFSLATNEMWRSGDSEVYQLGDVSQKTTWHRISVFRPGLRDVAYQYVKKGSRIYLEGKIDYGEYMDKNNVRRQATTIIADNIIFLSDQTKEKE
Sequence Similarities: Contains 1 SSB domain.
Gene Name: SSBP1 single-stranded DNA binding protein 1 [ Homo sapiens ]
Official Symbol: SSBP1
Synonyms: SSBP1; single-stranded DNA binding protein 1; single stranded DNA binding protein; single-stranded DNA-binding protein, mitochondrial; SSBP;
Gene ID: 6742
mRNA Refseq: NM_003143
Protein Refseq: NP_003134
MIM: 600439
Uniprot ID: Q04837
Chromosome Location: 7q34
Pathway: DNA replication, organism-specific biosystem; DNA replication, conserved biosystem; Homologous recombination, organism-specific biosystem; Homologous recombination, conserved biosystem; Mismatch repair, organism-specific biosystem;
Function: DNA binding; chromatin binding; single-stranded DNA binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.