"STAR" Related Products

Expand
Expand
Expand

Recombinant Human STAR

Cat.No.: STAR-30115TH
Product Overview: Recombinant full length Human StAR with N terminal proprietary tag, 57.46kDa inclusive of tag. Purified from an in vitro wheat germ expression system.
Description: The protein encoded by this gene plays a key role in the acute regulation of steroid hormone synthesis by enhancing the conversion of cholesterol into pregnenolone. This protein permits the cleavage of cholesterol into pregnenolone by mediating the transport of cholesterol from the outer mitochondrial membrane to the inner mitochondrial membrane. Mutations in this gene are a cause of congenital lipoid adrenal hyperplasia (CLAH), also called lipoid CAH. A pseudogene of this gene is located on chromosome 13.
Protein length: 286 amino acids
Molecular Weight: 57.460kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Expressed in gonads, adrenal cortex and kidney.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MLLATFKLCAGSSYRHMRNMKGLRQQAVMAISQELNRRAL GGPTPSTWINQVRRRSSLLGSRLEETLYSDQELAYLQQGE EAMQKALGILSNQEGWKKESQQDNGDKVMSKVVPDVGKVF RLEVVVDQPMERLYEELVERMEAMGEWNPNVKEIKVLQKI GKDTFITHELAAEAAGNLVGPRDFVSVRCAKRRGSTCVLA GMATDFGNMPEQKGVIRAEHGPTCMVLHPLAGSPSKTKLT WLLSIDLKGWLPKSIINQVLSQTQVDFANHLRKRLESHPA SEARC
Sequence Similarities: Contains 1 START domain.
Gene Name: STAR steroidogenic acute regulatory protein [ Homo sapiens ]
Official Symbol: STAR
Synonyms: STAR; steroidogenic acute regulatory protein; steroidogenic acute regulator; steroidogenic acute regulatory protein, mitochondrial; StAR; StAR related lipid transfer (START) domain containing 1; STARD1;
Gene ID: 6770
mRNA Refseq: NM_000349
Protein Refseq: NP_000340
MIM: 600617
Uniprot ID: P49675
Chromosome Location: 8p11.2
Pathway: Metabolism of lipids and lipoproteins, organism-specific biosystem; Metabolism of steroid hormones and vitamins A and D, organism-specific biosystem; Pregnenolone biosynthesis, organism-specific biosystem;
Function: cholesterol binding; cholesterol transporter activity; lipid binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.