Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at AACR Annual Meeting|Apr. 5-10, 2024|Booth #2953

Recombinant Human STAR, His-tagged

Cat.No. : STAR-30116TH
Product Overview : Recombinant full length Human StAR with an N terminal His tag; 243aa, 27.1kDa.
  • Specification
  • Gene Information
  • Related Products
Description : The protein encoded by this gene plays a key role in the acute regulation of steroid hormone synthesis by enhancing the conversion of cholesterol into pregnenolone. This protein permits the cleavage of cholesterol into pregnenolone by mediating the transport of cholesterol from the outer mitochondrial membrane to the inner mitochondrial membrane. Mutations in this gene are a cause of congenital lipoid adrenal hyperplasia (CLAH), also called lipoid CAH. A pseudogene of this gene is located on chromosome 13.
Protein length : 222 amino acids
Conjugation : HIS
Molecular Weight : 27.100kDa inclusive of tags
Source : E. coli
Tissue specificity : Expressed in gonads, adrenal cortex and kidney.
Form : Liquid
Purity : >90% by SDS-PAGE
Storage buffer : pH: 8.00Constituents:0.32% Tris HCl, 20% Glycerol, 0.03% DTT
Storage : Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMEETLYSDQELAYLQQGEEA MQKALGILSNQEGWKKESQQDNGDKVMSKVVPDVGKVFRL EVVVDQPMERLYEELVERMEAMGEWNPNVKEIKVLQKIGK DTFITHELAAEAAGNLVGPRDFVSVRCAKRRGSTCVLAGM ATDFGNMPEQKGVIRAEHGPTCMVLHPLAGSPSKTKLTWL LSIDLKGWLPKSIINQVLSQTQVDFANHLRKRLESHPASE ARC
Sequence Similarities : Contains 1 START domain.
Gene Name : STAR steroidogenic acute regulatory protein [ Homo sapiens ]
Official Symbol : STAR
Synonyms : STAR; steroidogenic acute regulatory protein; steroidogenic acute regulator; steroidogenic acute regulatory protein, mitochondrial; StAR; StAR related lipid transfer (START) domain containing 1; STARD1;
Gene ID : 6770
mRNA Refseq : NM_000349
Protein Refseq : NP_000340
MIM : 600617
Uniprot ID : P49675
Chromosome Location : 8p11.2
Pathway : Metabolism of lipids and lipoproteins, organism-specific biosystem; Metabolism of steroid hormones and vitamins A and D, organism-specific biosystem; Pregnenolone biosynthesis, organism-specific biosystem;
Function : cholesterol binding; cholesterol transporter activity; lipid binding;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends