"SYT1" Related Products

Expand
Expand
Expand

Recombinant Human SYT1, His-tagged

Cat.No.: SYT1-31491TH
Product Overview: Recombinant fragment corresponding to amino acids 136-382 of Human Synaptotagmin 1 with C terminal His tag; 256 amino acids with tag, Predicted MWt 29.5 kDa.
Description: The synaptotagmins are integral membrane proteins of synaptic vesicles thought to serve as Ca(2+) sensors in the process of vesicular trafficking and exocytosis. Calcium binding to synaptotagmin-1 participates in triggering neurotransmitter release at the synapse (Fernandez-Chacon et al.
Protein length: 247 amino acids
Conjugation: HIS
Molecular Weight: 29.500kDa inclusive of tags
Source: E. coli
Form: Liquid
Purity: by SDS-PAGE
Storage buffer: Preservative: NoneConstituents: 20% Glycerol, 20mM Tris HCl, 2mM DTT, 100mM Sodium chloride, pH 8.0
Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: MEPKEEEKLGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSAEKEEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNLEHHHHHH
Sequence Similarities: Belongs to the synaptotagmin family.Contains 2 C2 domains.
Gene Name: SYT1 synaptotagmin I [ Homo sapiens ]
Official Symbol: SYT1
Synonyms: SYT1; synaptotagmin I; SVP65, SYT; synaptotagmin-1; P65;
Gene ID: 6857
mRNA Refseq: NM_001135805
Protein Refseq: NP_001129277
MIM: 185605
Uniprot ID: P21579
Chromosome Location: 12cen-q21
Pathway: Acetylcholine Neurotransmitter Release Cycle, organism-specific biosystem; Botulinum neurotoxicity, organism-specific biosystem; Dopamine Neurotransmitter Release Cycle, organism-specific biosystem; Effects of Botulinum toxin, organism-specific biosystem; GABA synthesis, release, reuptake and degradation, organism-specific biosystem;
Function: 1-phosphatidylinositol binding; calcium ion binding; calcium-dependent protein binding; calmodulin binding; identical protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.