"TADA3" Related Products

Expand

Recombinant Human TADA3, His-tagged

Cat.No.: TADA3-30934TH
Product Overview: Recombinant fragment, corresponding to amino acids 87-432 of Human TADA3L with N terminal His tag. Predicted MWt 40 kDa;
Description: Many DNA-binding transcriptional activator proteins enhance the initiation rate of RNA polymerase II-mediated gene transcription by interacting functionally with the general transcription machinery bound at the basal promoter. Adaptor proteins are usually required for this activation, possibly to acetylate and destabilize nucleosomes, thereby relieving chromatin constraints at the promoter. The protein encoded by this gene is a transcriptional activator adaptor and has been found to be part of the PCAF histone acetylase complex. In addition, it associates with the tumor suppressor protein p53 and is required for full activity of p53 and p53-mediated apoptosis. At least four alternatively spliced variants have been found for this gene, but the full-length nature of some variants has not been determined.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitute with 54 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: GRDHELGAPPKHGKPKKQKLEGKAGHGPGPGPGRPKSKNL QPKIQEYEFTDDPIDVPRIPKNDAPNRFWASVEPYCAD ITSEEVRTLEELLKPPEDEAEHYKIPPLGKHYSQRWAQ EDLLEEQKDGARAAAVADKKKGLMGPLTELDTKDVDAL LKKSEAQHEQPEDGCPFGALTQRLLQALVEENIISPME DSPIPDMSGKESGADGASTSPRNQNKPFSVPHTKSLES RIKEELIAQGLLESEDRPAEDSEDEVLAELRKRQAELK ALSAHNRTKKHDLLRLAKEEVSRQELRQRVRMADNEVM DAFRKIMAARQKKRTPTKKEKDQAWKTLKERESILKLL DG
Gene Name: TADA3 transcriptional adaptor 3 [ Homo sapiens ]
Official Symbol: TADA3
Synonyms: TADA3; transcriptional adaptor 3; TADA3L, transcriptional adaptor 3 (NGG1 homolog, yeast) like; transcriptional adapter 3; ADA3; FLJ20221; FLJ21329; hADA3; NGG1;
Gene ID: 10474
mRNA Refseq: NM_006354
Protein Refseq: NP_006345
MIM: 602945
Uniprot ID: O75528
Chromosome Location: 3p25.3
Function: contributes_to histone acetyltransferase activity; ligand-dependent nuclear receptor binding; ligand-dependent nuclear receptor transcription coactivator activity; protein binding; protein domain specific binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.