Recombinant Human TADA3, His-tagged
Cat.No. : | TADA3-30934TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 87-432 of Human TADA3L with N terminal His tag. Predicted MWt 40 kDa; |
- Specification
- Gene Information
- Related Products
Description : | Many DNA-binding transcriptional activator proteins enhance the initiation rate of RNA polymerase II-mediated gene transcription by interacting functionally with the general transcription machinery bound at the basal promoter. Adaptor proteins are usually required for this activation, possibly to acetylate and destabilize nucleosomes, thereby relieving chromatin constraints at the promoter. The protein encoded by this gene is a transcriptional activator adaptor and has been found to be part of the PCAF histone acetylase complex. In addition, it associates with the tumor suppressor protein p53 and is required for full activity of p53 and p53-mediated apoptosis. At least four alternatively spliced variants have been found for this gene, but the full-length nature of some variants has not been determined. |
Conjugation : | HIS |
Source : | E. coli |
Form : | Lyophilised:Reconstitute with 54 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | GRDHELGAPPKHGKPKKQKLEGKAGHGPGPGPGRPKSKNL QPKIQEYEFTDDPIDVPRIPKNDAPNRFWASVEPYCAD ITSEEVRTLEELLKPPEDEAEHYKIPPLGKHYSQRWAQ EDLLEEQKDGARAAAVADKKKGLMGPLTELDTKDVDAL LKKSEAQHEQPEDGCPFGALTQRLLQALVEENIISPME DSPIPDMSGKESGADGASTSPRNQNKPFSVPHTKSLES RIKEELIAQGLLESEDRPAEDSEDEVLAELRKRQAELK ALSAHNRTKKHDLLRLAKEEVSRQELRQRVRMADNEVM DAFRKIMAARQKKRTPTKKEKDQAWKTLKERESILKLL DG |
Gene Name : | TADA3 transcriptional adaptor 3 [ Homo sapiens ] |
Official Symbol : | TADA3 |
Synonyms : | TADA3; transcriptional adaptor 3; TADA3L, transcriptional adaptor 3 (NGG1 homolog, yeast) like; transcriptional adapter 3; ADA3; FLJ20221; FLJ21329; hADA3; NGG1; |
Gene ID : | 10474 |
mRNA Refseq : | NM_006354 |
Protein Refseq : | NP_006345 |
MIM : | 602945 |
Uniprot ID : | O75528 |
Chromosome Location : | 3p25.3 |
Function : | contributes_to histone acetyltransferase activity; ligand-dependent nuclear receptor binding; ligand-dependent nuclear receptor transcription coactivator activity; protein binding; protein domain specific binding; |
Products Types
◆ Recombinant Protein | ||
TADA3-8962M | Recombinant Mouse TADA3 Protein, His (Fc)-Avi-tagged | +Inquiry |
TADA3-5570R | Recombinant Rat TADA3 Protein, His (Fc)-Avi-tagged | +Inquiry |
TADA3-133H | Recombinant Human TADA3L Protein, MYC/DDK-tagged | +Inquiry |
Tada3-176M | Recombinant Mouse Tada3 Protein, MYC/DDK-tagged | +Inquiry |
TADA3-4420R | Recombinant Rhesus Macaque TADA3 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Lysates | ||
TADA3-1279HCL | Recombinant Human TADA3 293 Cell Lysate | +Inquiry |
TADA3-1278HCL | Recombinant Human TADA3 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket