Recombinant Human TCF4 protein, GST-tagged

Cat.No. : TCF4-29463TH
Product Overview : Recombinant Human TCF4 full-length ORF ( AAH31056.1, 1 a.a. - 365 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 65.89kDa
AA Sequence : MHHQQRMAALGTDKELSDLLDFSAMFSPPVSSGKNGPTSLASGHFTGSNVEDRSSSGSWGNGGHPSPSRNYGDGT PYDHTTSRDLGSHDNLSPPFVNSRIQSKTERGSYSSYGRESNLQGCHQQSLLGGDMDMGNPGTLSPTKPGSQYYQ YSSNNPRRRPLHSSAMEVQTKKVRKVPPGLPSSVYAPSASTADYNRDSPGYPSSKPATSTFPSSFFMQDGHHSSD PWSSSSGMNQPGYAGMLGNSSHIPQSSSYCSLHPHERLSYPSHSSADINSSLPPMSTFHRSGTNHYSTSSCTPPA NGTDSIMANRGSGAAGSSQTGDALGKALASIYSPDHTNNSFSSNPSTPVGSPPSLSAGTAVWSRN
Applications : ELISA; WB; Antibody Production; Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name TCF4 transcription factor 4 [ Homo sapiens ]
Official Symbol TCF4
Synonyms TCF4; transcription factor 4; bHLHb19; E2 2; ITF2; SEF2 1B; SL3-3 enhancer factor 2; transcription factor 4, isoform D; transcription factor 4, isoform R; immunoglobulin transcription factor 2; class B basic helix-loop-helix protein 19; E2-2; PTHS; SEF2; ITF-2; SEF-2; TCF-4; SEF2-1; SEF2-1A; SEF2-1B; MGC149723; MGC149724;
Gene ID 6925
mRNA Refseq NM_001083962
Protein Refseq NP_001077431
MIM 602272
UniProt ID P15884
Chromosome Location 18q21.1
Pathway CDO in myogenesis, organism-specific biosystem; Coregulation of Androgen receptor activity, organism-specific biosystem; Developmental Biology, organism-specific biosystem; Myogenesis, organism-specific biosystem; Regulation of Wnt-mediated beta catenin signaling and target gene transcription, organism-specific biosystem; Wnt Signaling Pathway NetPath, organism-specific biosystem;
Function DNA binding; E-box binding; RNA polymerase II core promoter proximal region sequence-specific DNA binding; RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in positive regulation of transcription; TFIIB-class binding transcription factor activity; TFIIB-class transcription factor binding; protein C-terminus binding; protein binding; protein heterodimerization activity; protein heterodimerization activity; sequence-specific DNA binding RNA polymerase recruiting transcription factor activity; sequence-specific DNA binding transcription factor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TCF4 Products

Required fields are marked with *

My Review for All TCF4 Products

Required fields are marked with *

0
cart-icon
0
compare icon