Recombinant Human TCF4 protein, GST-tagged TCF4-29463TH

Recombinant Human TCF4 protein, GST-tagged

PRODUCTS

Home / Products / Recombinant Human TCF4 protein, GST-tagged

Recombinant Human TCF4 protein, GST-tagged

TCF4 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : TCF4-29463TH
Product Overview : Recombinant Human TCF4 full-length ORF ( AAH31056.1, 1 a.a. - 365 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
Source : Wheat Germ
Species : Human
Tag : GST
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 65.89kDa
AA Sequence : MHHQQRMAALGTDKELSDLLDFSAMFSPPVSSGKNGPTSLASGHFTGSNVEDRSSSGSWGNGGHPSPSRNYGDGT PYDHTTSRDLGSHDNLSPPFVNSRIQSKTERGSYSSYGRESNLQGCHQQSLLGGDMDMGNPGTLSPTKPGSQYYQ YSSNNPRRRPLHSSAMEVQTKKVRKVPPGLPSSVYAPSASTADYNRDSPGYPSSKPATSTFPSSFFMQDGHHSSD PWSSSSGMNQPGYAGMLGNSSHIPQSSSYCSLHPHERLSYPSHSSADINSSLPPMSTFHRSGTNHYSTSSCTPPA NGTDSIMANRGSGAAGSSQTGDALGKALASIYSPDHTNNSFSSNPSTPVGSPPSLSAGTAVWSRN
Applications : ELISA; WB; Antibody Production; Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name : TCF4 transcription factor 4 [ Homo sapiens ]
Official Symbol : TCF4
Synonyms : TCF4; transcription factor 4; bHLHb19; E2 2; ITF2; SEF2 1B; SL3-3 enhancer factor 2; transcription factor 4, isoform D; transcription factor 4, isoform R; immunoglobulin transcription factor 2; class B basic helix-loop-helix protein 19; E2-2; PTHS; SEF2; ITF-2; SEF-2; TCF-4; SEF2-1; SEF2-1A; SEF2-1B; MGC149723; MGC149724;
Gene ID : 6925
mRNA Refseq : NM_001083962
Protein Refseq : NP_001077431
MIM : 602272
UniProt ID : P15884
Chromosome Location : 18q21.1
Pathway : CDO in myogenesis, organism-specific biosystem; Coregulation of Androgen receptor activity, organism-specific biosystem; Developmental Biology, organism-specific biosystem; Myogenesis, organism-specific biosystem; Regulation of Wnt-mediated beta catenin signaling and target gene transcription, organism-specific biosystem; Wnt Signaling Pathway NetPath, organism-specific biosystem;
Function : DNA binding; E-box binding; RNA polymerase II core promoter proximal region sequence-specific DNA binding; RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in positive regulation of transcription; TFIIB-class binding transcription factor activity; TFIIB-class transcription factor binding; protein C-terminus binding; protein binding; protein heterodimerization activity; protein heterodimerization activity; sequence-specific DNA binding RNA polymerase recruiting transcription factor activity; sequence-specific DNA binding transcription factor activity;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy