"TCF4" Related Products

Expand
Expand

Recombinant Human TCF4 protein, GST-tagged

Cat.No.: TCF4-29463TH
Product Overview: Recombinant Human TCF4 full-length ORF ( AAH31056.1, 1 a.a. - 365 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
Source: Wheat Germ
Species: Human
Tag: GST
Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass: 65.89kDa
AA Sequence: MHHQQRMAALGTDKELSDLLDFSAMFSPPVSSGKNGPTSLASGHFTGSNVEDRSSSGSWGNGGHPSPSRNYGDGT PYDHTTSRDLGSHDNLSPPFVNSRIQSKTERGSYSSYGRESNLQGCHQQSLLGGDMDMGNPGTLSPTKPGSQYYQ YSSNNPRRRPLHSSAMEVQTKKVRKVPPGLPSSVYAPSASTADYNRDSPGYPSSKPATSTFPSSFFMQDGHHSSD PWSSSSGMNQPGYAGMLGNSSHIPQSSSYCSLHPHERLSYPSHSSADINSSLPPMSTFHRSGTNHYSTSSCTPPA NGTDSIMANRGSGAAGSSQTGDALGKALASIYSPDHTNNSFSSNPSTPVGSPPSLSAGTAVWSRN
Applications: ELISA; WB; Antibody Production; Protein Array
Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name: TCF4 transcription factor 4 [ Homo sapiens ]
Official Symbol: TCF4
Synonyms: TCF4; transcription factor 4; bHLHb19; E2 2; ITF2; SEF2 1B; SL3-3 enhancer factor 2; transcription factor 4, isoform D; transcription factor 4, isoform R; immunoglobulin transcription factor 2; class B basic helix-loop-helix protein 19; E2-2; PTHS; SEF2; ITF-2; SEF-2; TCF-4; SEF2-1; SEF2-1A; SEF2-1B; MGC149723; MGC149724;
Gene ID: 6925
mRNA Refseq: NM_001083962
Protein Refseq: NP_001077431
MIM: 602272
UniProt ID: P15884
Chromosome Location: 18q21.1
Pathway: CDO in myogenesis, organism-specific biosystem; Coregulation of Androgen receptor activity, organism-specific biosystem; Developmental Biology, organism-specific biosystem; Myogenesis, organism-specific biosystem; Regulation of Wnt-mediated beta catenin signaling and target gene transcription, organism-specific biosystem; Wnt Signaling Pathway NetPath, organism-specific biosystem;
Function: DNA binding; E-box binding; RNA polymerase II core promoter proximal region sequence-specific DNA binding; RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in positive regulation of transcription; TFIIB-class binding transcription factor activity; TFIIB-class transcription factor binding; protein C-terminus binding; protein binding; protein heterodimerization activity; protein heterodimerization activity; sequence-specific DNA binding RNA polymerase recruiting transcription factor activity; sequence-specific DNA binding transcription factor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.