Recombinant Full Length Human TCF4 Protein, C-Flag-tagged
Cat.No. : | TCF4-742HFL |
Product Overview : | Recombinant Full Length Human TCF4 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes transcription factor 4, a basic helix-loop-helix transcription factor. The encoded protein recognizes an Ephrussi-box ('E-box') binding site ('CANNTG') - a motif first identified in immunoglobulin enhancers. This gene is broadly expressed, and may play an important role in nervous system development. Defects in this gene are a cause of Pitt-Hopkins syndrome. In addition, an intronic CTG repeat normally numbering 10-37 repeat units can expand to >50 repeat units and cause Fuchs endothelial corneal dystrophy. Multiple alternatively spliced transcript variants that encode different proteins have been described. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 71.6 kDa |
AA Sequence : | MHHQQRMAALGTDKELSDLLDFSAMFSPPVSSGKNGPTSLASGHFTGSNVEDRSSSGSWGNGGHPSPSRN YGDGTPYDHMTSRDLGSHDNLSPPFVNSRIQSKTERGSYSSYGRESNLQGCHQQSLLGGDMDMGNPGTLS PTKPGSQYYQYSSNNPRRRPLHSSAMEVQTKKVRKVPPGLPSSVYAPSASTADYNRDSPGYPSSKPATST FPSSFFMQDGHHSSDPWSSSSGMNQPGYAGMLGNSSHIPQSSSYCSLHPHERLSYPSHSSADINSSLPPM STFHRSGTNHYSTSSCTPPANGTDSIMANRGSGAAGSSQTGDALGKALASIYSPDHTNNSFSSNPSTPVG SPPSLSAGTAVWSRNGGQASSSPNYEGPLHSLQSRIEDRLERLDDAIHVLRNHAVGPSTAMPGGHGDMHG IIGPSHNGAMGGLGSGYGTGLLSANRHSLMVGTHREDGVALRGSHSLLPNQVPVPQLPVQSATSPDLNPP QDPYRGMPPGLQGQSVSSGSSEIKSDDEGDENLQDTKSSEDKKLDDDKKDIKSITRSRSSNNDDEDLTPE QKAEREKERRMANNARERLRVRDINEAFKELGRMVQLHLKSDKPQTKLLILHQAVAVILSLEQQVRERNL NPKAACLKRREEEKVSSEPPPLSLAGPHPGMGDASNHMGQMTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, ES Cell Differentiation/IPS, Transcription Factors |
Full Length : | Full L. |
Gene Name | TCF4 transcription factor 4 [ Homo sapiens (human) ] |
Official Symbol | TCF4 |
Synonyms | E2-2; ITF2; PTHS; SEF2; CDG2T; FECD3; ITF-2; SEF-2; TCF-4; SEF2-1; SEF2-1A; SEF2-1B; SEF2-1D; bHLHb19 |
Gene ID | 6925 |
mRNA Refseq | NM_001083962.2 |
Protein Refseq | NP_001077431.1 |
MIM | 602272 |
UniProt ID | P15884 |
◆ Recombinant Proteins | ||
TCF4-30167H | Recombinant Human TCF4 protein, GST-tagged | +Inquiry |
TCF4-580H | Recombinant Human TCF4 Protein, His-tagged | +Inquiry |
TCF4-31H | Recombinant Human TCF4 protein, His-tagged | +Inquiry |
TCF4-5649R | Recombinant Rat TCF4 Protein, His (Fc)-Avi-tagged | +Inquiry |
TCF4-12H | Recombinant Human TCF4 Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TCF4-1179HCL | Recombinant Human TCF4 293 Cell Lysate | +Inquiry |
TCF4-1178HCL | Recombinant Human TCF4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TCF4 Products
Required fields are marked with *
My Review for All TCF4 Products
Required fields are marked with *
0
Inquiry Basket