Recombinant Human TCF4 protein, GST-tagged
Cat.No. : | TCF4-30167H |
Product Overview : | Recombinant Human TCF4 (407-560 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Pro407-Glu560 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | PSTAMPGGHGDMHGIIGPSHNGAMGGLGSGYGTGLLSANRHSLMVGTHREDGVALRGSHSLLPNQVPVPQLPVQSATSPDLNPPQDPYRGMPPGLQGQSVSSGSSEIKSDDEGDENLQDTKSSEDKKLDDDKKDIKSITRSRSSNNDDEDLTPE |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | TCF4 transcription factor 4 [ Homo sapiens ] |
Official Symbol | TCF4 |
Synonyms | TCF4; transcription factor 4; bHLHb19; E2 2; ITF2; SEF2 1B; SL3-3 enhancer factor 2; transcription factor 4, isoform D; transcription factor 4, isoform R; immunoglobulin transcription factor 2; class B basic helix-loop-helix protein 19; E2-2; PTHS; SEF2; ITF-2; SEF-2; TCF-4; SEF2-1; SEF2-1A; SEF2-1B; MGC149723; MGC149724; |
Gene ID | 6925 |
mRNA Refseq | NM_001083962 |
Protein Refseq | NP_001077431 |
MIM | 602272 |
UniProt ID | P15884 |
◆ Recombinant Proteins | ||
TCF4-2168H | Recombinant Human TCF4 Protein, His (Fc)-Avi-tagged | +Inquiry |
TCF4-580H | Recombinant Human TCF4 Protein, His-tagged | +Inquiry |
TCF4-9081M | Recombinant Mouse TCF4 Protein, His (Fc)-Avi-tagged | +Inquiry |
TCF4-5109H | Recombinant Human TCF4, His-tagged | +Inquiry |
TCF4-5649R | Recombinant Rat TCF4 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TCF4-1179HCL | Recombinant Human TCF4 293 Cell Lysate | +Inquiry |
TCF4-1178HCL | Recombinant Human TCF4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TCF4 Products
Required fields are marked with *
My Review for All TCF4 Products
Required fields are marked with *
0
Inquiry Basket