"TKT" Related Products

Expand
Expand

Recombinant Human TKT, His-tagged

Cat.No.: TKT-30354TH
Product Overview: Recombinant fragment, corresponding to amino acids 29-540 of Human Transketolase with an N terminal His tag. Predicted MWt: 57 kDa;
Description: This gene encodes a thiamine-dependent enzyme which plays a role in the channeling of excess sugar phosphates to glycolysis in the pentose phosphate pathway. Multiple alternatively spliced variants, encoding the same protein, have been identified.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitute with 145 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: ATTAAGSGHPTSCCSAAEIMAVLFFHTGKYFDKASYRVYC LLGDGELSEGSVWEAMAFASIYKLDNLVAILDINRLGQ SDPAPLQHQMDIYQKRCEAFGWHAIIVDGHSVEELCKA FGQAKHQPTAIIAKTFKGRGITGVEDKESWHGKPLPKNMA EQIIQEIYSQIQSKKKILATPPQEDAPSVDIANIRMPS LPSYKVGDKIATRKAYGQALAKLGHASDRIIALDGDTK NSTFSEIFKKEHPDRFIECYIAEQNMVSIAVGCATRNRTV PFCSTFAAFFTRAFDQIRMAAISESNINLCGSHCGVSI GEDGPSQMALEDLAMFRSVPTSTVFYPSDGVATEKAVE LAANTKGICFIRTSRPENAIIYNNNEDFQVGQAKVVLKSK DDQVTVIGAGVTLHEALAAAELLKKEKINIRVLDPFTI KPLDRKLILDSARATKGRILTVEDHYYEGGIGEAVSSA VVGEPGITVTHLAVNRVPRSGKPAELLKMFGIDRDAIAQA VRGLITKA
Sequence Similarities: Belongs to the transketolase family.
Gene Name: TKT transketolase [ Homo sapiens ]
Official Symbol: TKT
Synonyms: TKT; transketolase; Wernicke Korsakoff syndrome;
Gene ID: 7086
mRNA Refseq: NM_001064
Protein Refseq: NP_001055
MIM: 606781
Uniprot ID: P29401
Chromosome Location: 3p14.3
Pathway: Insulin effects increased synthesis of Xylulose-5-Phosphate, organism-specific biosystem; Integration of energy metabolism, organism-specific biosystem; Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of carbohydrates, organism-specific biosystem;
Function: magnesium ion binding; monosaccharide binding; thiamine pyrophosphate binding; transferase activity; transketolase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.