Recombinant Human TOMM40, His-tagged
Cat.No. : | TOMM40-31537TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 55-361 of Human TOMM40 with N terminal His tag; Predicted MWt 34 kDa. |
- Specification
- Gene Information
- Related Products
Description : | TOMM40 is the channel-forming subunit of the translocase of the mitochondrial outer membrane (TOM) complex that is essential for protein import into mitochondria (Humphries et al. |
Conjugation : | HIS |
Source : | E. coli |
Form : | Lyophilised:Reconstitute with 101 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | ERTPGAATASASGAAEDGACGCLPNPGTFEECHRKCKELF PIQMEGVKLTVNKGLSNHFQVNHTVALSTIGESNYHFG VTYVGTKQLSPTEAFPVLVGDMDNSGSLNAQVIHQLGP GLRSKMAIQTQQSKFVNWQVDGEYRGSDFTAAVTLGNP DVLVGSGILVAHYLQSITPCLALGGELVYHRRPGEEGTVM SLAGKYTLNNWLATVTLGQAGMHATYYHKASDQLQVGV EFEASTRMQDTSVSFGYQLDLPKANLLFKGSVDSNWIV GATLEKKLPPLPLTLALGAFLNHRKNKFQCGFGLTIG |
Sequence Similarities : | Belongs to the Tom40 family. |
Gene Name : | TOMM40 translocase of outer mitochondrial membrane 40 homolog (yeast) [ Homo sapiens ] |
Official Symbol : | TOMM40 |
Synonyms : | TOMM40; translocase of outer mitochondrial membrane 40 homolog (yeast); mitochondrial import receptor subunit TOM40 homolog; C19orf1; D19S1177E; PER EC1; PEREC1; TOM40; |
Gene ID : | 10452 |
mRNA Refseq : | NM_001128916 |
Protein Refseq : | NP_001122388 |
MIM : | 608061 |
Uniprot ID : | O96008 |
Chromosome Location : | 19q13 |
Pathway : | Amyotrophic lateral sclerosis (ALS), organism-specific biosystem; Amyotrophic lateral sclerosis (ALS), conserved biosystem; |
Function : | porin activity; protein transmembrane transporter activity; protein transmembrane transporter activity; voltage-gated anion channel activity; |
Products Types
◆ Recombinant Protein | ||
TOMM40-4708R | Recombinant Rhesus Macaque TOMM40 Protein, His (Fc)-Avi-tagged | +Inquiry |
TOMM40-5876R | Recombinant Rat TOMM40 Protein, His (Fc)-Avi-tagged | +Inquiry |
TOMM40-30H | Recombinant Human TOMM40 protein, His-tagged | +Inquiry |
TOMM40-10015Z | Recombinant Zebrafish TOMM40 | +Inquiry |
TOMM40-5541H | Recombinant Human TOMM40 Protein (Met1-Gly361), N-His tagged | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (0)
Ask a questionAsk a Question for All TOMM40 Products
Required fields are marked with *
My Review for All TOMM40 Products
Required fields are marked with *
0
Inquiry Basket