"TPI1" Related Products

Expand

Recombinant Human TPI1

Cat.No. : TPI1-31613TH
Product Overview : Recombinant full length Human Triosephosphate isomerase, expressed in Saccharomyces cerevisiae, amino acids 1-249. MW 26.6 kDa.
Description : This gene encodes an enzyme, consisting of two identical proteins, which catalyzes the isomerization of glyceraldehydes 3-phosphate (G3P) and dihydroxy-acetone phosphate (DHAP) in glycolysis and gluconeogenesis. Mutations in this gene are associated with triosephosphate isomerase deficiency. Pseudogenes have been identified on chromosomes 1, 4, 6 and 7. Alternative splicing results in multiple transcript variants.
Form : Liquid
Purity : >90% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
Sequences of amino acids : MAPSRKFFVGGNWKMNGRKQSLGELIGTLNAAKVPADTEV VCAPPTAYIDFARQKLDPKIAVAAQNCYKVTNGAFTGE ISPGMIKDCGATWVVLGHSERRHVFGESDELIGQKVAH ALAEGLGVIACIGEKLDEREAGITEKVVFEQTKVIADN VKDWSKVVLAYEPVWAIGTGKTATPQQAQEVHEKLRGW LKSNVSDAVAQSTRIIYGGSVTGATCKELASQPDVDGF LVGGASLKPEFVDIINAKQ
Gene Name : TPI1 triosephosphate isomerase 1 [ Homo sapiens ]
Official Symbol : TPI1
Synonyms : TPI1; triosephosphate isomerase 1; triosephosphate isomerase;
Gene ID : 7167
mRNA Refseq : NM_000365
Protein Refseq : NP_000356
Uniprot ID : P60174
Chromosome Location : 12p13.31
Pathway : Fatty Acid Beta Oxidation, organism-specific biosystem; Fructose and mannose metabolism, organism-specific biosystem; Fructose and mannose metabolism, conserved biosystem; Gluconeogenesis, organism-specific biosystem; Gluconeogenesis, oxaloacetate =>
Function : isomerase activity; triose-phosphate isomerase activity; triose-phosphate isomerase activity; triose-phosphate isomerase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.