Recombinant Human TPI1
Cat.No. : | TPI1-31613TH |
Product Overview : | Recombinant full length Human Triosephosphate isomerase, expressed in Saccharomyces cerevisiae, amino acids 1-249. MW 26.6 kDa. |
- Specification
- Gene Information
- Related Products
Description : | This gene encodes an enzyme, consisting of two identical proteins, which catalyzes the isomerization of glyceraldehydes 3-phosphate (G3P) and dihydroxy-acetone phosphate (DHAP) in glycolysis and gluconeogenesis. Mutations in this gene are associated with triosephosphate isomerase deficiency. Pseudogenes have been identified on chromosomes 1, 4, 6 and 7. Alternative splicing results in multiple transcript variants. |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MAPSRKFFVGGNWKMNGRKQSLGELIGTLNAAKVPADTEV VCAPPTAYIDFARQKLDPKIAVAAQNCYKVTNGAFTGE ISPGMIKDCGATWVVLGHSERRHVFGESDELIGQKVAH ALAEGLGVIACIGEKLDEREAGITEKVVFEQTKVIADN VKDWSKVVLAYEPVWAIGTGKTATPQQAQEVHEKLRGW LKSNVSDAVAQSTRIIYGGSVTGATCKELASQPDVDGF LVGGASLKPEFVDIINAKQ |
Gene Name : | TPI1 triosephosphate isomerase 1 [ Homo sapiens ] |
Official Symbol : | TPI1 |
Synonyms : | TPI1; triosephosphate isomerase 1; triosephosphate isomerase; |
Gene ID : | 7167 |
mRNA Refseq : | NM_000365 |
Protein Refseq : | NP_000356 |
Uniprot ID : | P60174 |
Chromosome Location : | 12p13.31 |
Pathway : | Fatty Acid Beta Oxidation, organism-specific biosystem; Fructose and mannose metabolism, organism-specific biosystem; Fructose and mannose metabolism, conserved biosystem; Gluconeogenesis, organism-specific biosystem; Gluconeogenesis, oxaloacetate => |
Function : | isomerase activity; triose-phosphate isomerase activity; triose-phosphate isomerase activity; triose-phosphate isomerase activity; |
Products Types
◆ Recombinant Protein | ||
TPI1-5898R | Recombinant Rat TPI1 Protein, His (Fc)-Avi-tagged | +Inquiry |
TPI1-0193H | Recombinant Human TPI1 Protein (M1-Q249), His/Strep tagged | +Inquiry |
TPI1-640H | Recombinant Human TPI1 Protein, His-tagged | +Inquiry |
TPI1-2240H | Recombinant Human TPI1 Protein, His (Fc)-Avi-tagged | +Inquiry |
TPI1-1300H | Recombinant Human TPI1 Protein (M1-Q249), Tag Free | +Inquiry |
◆ Lysates | ||
TPI1-846HCL | Recombinant Human TPI1 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket