"TRADD" Related Products

Expand

Recombinant Human TRADD, His-tagged

Cat.No.: TRADD-29977TH
Product Overview: Recombinant full length protein, corresponding to amino acids 1-150 of Human TRADD with an N terminal His tag; Predicted MWt 17 kDa.
Description: The protein encoded by this gene is a death domain containing adaptor molecule that interacts with TNFRSF1A/TNFR1 and mediates programmed cell death signaling and NF-kappaB activation. This protein binds adaptor protein TRAF2, reduces the recruitment of inhibitor-of-apoptosis proteins (IAPs) by TRAF2, and thus suppresses TRAF2 mediated apoptosis. This protein can also interact with receptor TNFRSF6/FAS and adaptor protein FADD/MORT1, and is involved in the Fas-induced cell death pathway.
Conjugation: HIS
Source: E. coli
Tissue specificity: Found in all examined tissues.
Form: Lyophilised:Reconstitute with 113 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MAAGQNGHEEWVGSAYLFVESSLDKVVLSDAYAHPQQKVA VYRALQAALAALLAQDPSPVPTLPGPPFPSQGRGHRRL KRVGGSVRGLRAARAPLLPEQWESRLVEAEDLRPLALL CPAGRLPRRLVCPGHTPPFLCFEVPLFCQPSFGA
Sequence Similarities: Contains 1 death domain.
Gene Name: TRADD TNFRSF1A-associated via death domain [ Homo sapiens ]
Official Symbol: TRADD
Synonyms: TRADD; TNFRSF1A-associated via death domain; tumor necrosis factor receptor type 1-associated DEATH domain protein; Hs.89862;
Gene ID: 8717
mRNA Refseq: NM_003789
Protein Refseq: NP_003780
MIM: 603500
Uniprot ID: Q15628
Chromosome Location: 16q22
Pathway: Activation of Pro-Caspase 8, organism-specific biosystem; Adipocytokine signaling pathway, organism-specific biosystem; Adipocytokine signaling pathway, conserved biosystem; Apoptosis, organism-specific biosystem; Apoptosis, organism-specific biosystem;
Function: binding, bridging; death domain binding; identical protein binding; kinase binding; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.