Recombinant Zebrafish TRADD Protein, His tagged

• Cat.No.: TRADD-9147Z
• Product Overview: Recombinant Zebrafish TRADD Protein with His tag was expressed in HEK293.

Specification

• Species: Zebrafish
• Source: HEK293
• Tag: His
• Protein Length: 1-293 aa
• Description: Predicted to enable transmembrane receptor protein tyrosine kinase adaptor activity. Acts upstream of or within positive regulation of apoptotic process. Predicted to be located in cytoplasm; cytoskeleton; and nucleus. Predicted to be part of tumor necrosis factor receptor superfamily complex. Orthologous to human TRADD (TNFRSF1A associated via death domain).
• AASequence: MDSIDTKRLNDSNASDRALSGCAVLFLGCSSLEHNFLSLYKDERGKFSVFKVIKLTLSDSVGGLEGYEILKLHDADPYLGVELKFMAMPPCQRFLESYACGSLTQFLSQHASRLLALPDGVEIETQLKAGVHTLDHSLQDIEICLDHIRQSQPVRLRDDEVTQLEQQLQNSYGPPSQPPQELPRNCFLFQKRVFDDRPLTPADQQRFAAHVGRDWKRVGRALQKNCRALKGPAIDNLAYEYEREGLYEQAYQLLGRFIQSEGRSAKLSRLISALEETKMTSMAEIMLGIQPRDHHHHHHHHHH
• Molecular Mass: 35 kDa
• Endotoxin: < 1 EU/μg by LAL
• Purity: > 80% by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Storage Buffer: Lyophilized from PBS, pH7.4, 0.1% SKL, 5% Trehalose, 5% Mannitol
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.165 mg/mL. Centrifuge the vial at 4 centigrade before opening to recover the entire contents.

Gene Information

• Gene Name 2: tradd tnfrsf1a-associated via death domain [ Danio rerio (zebrafish) ]
• Official Symbol 2: tradd
• Synonyms 2: tradd; tnfrsf1a-associated via death domain; zehn0873; wu:fc59e02; zgc:103556; hm:zehn0873; tumor necrosis factor receptor type 1-associated DEATH domain protein; TNFR1-associated DEATH domain protein; TNFRSF1A-associated via death domain protein
• Gene ID 2: 58130
• mRNA Refseq 2: NM_131607
• Protein Refseq 2: NP_571682
• UniProt ID 2: Q9I9N5