Recombinant Human TRAF1, His-tagged

• Cat.No.: TRAF1-29978TH
• Product Overview: Recombinant fragment of Human TRAF1 fused to a 21 amino acid His tag at the N terminus; 172aa, 19.5 kDa.

Specification

• Description: The protein encoded by this gene is a member of the TNF receptor (TNFR) associated factor (TRAF) protein family. TRAF proteins associate with, and mediate the signal transduction from various receptors of the TNFR superfamily. This protein and TRAF2 form a heterodimeric complex, which is required for TNF-alpha-mediated activation of MAPK8/JNK and NF-kappaB. The protein complex formed by this protein and TRAF2 also interacts with inhibitor-of-apoptosis proteins (IAPs), and thus mediates the anti-apoptotic signals from TNF receptors. The expression of this protein can be induced by Epstein-Barr virus (EBV). EBV infection membrane protein 1 (LMP1) is found to interact with this and other TRAF proteins; this interaction is thought to link LMP1-mediated B lymphocyte transformation to the signal transduction from TNFR family receptors. Three transcript variants encoding two different isoforms have been found for this gene.
• Protein length: 151 amino acids
• Conjugation: HIS
• Molecular Weight: 19.500kDa
• Source: E. coli
• Form: Liquid
• Purity: >95% by SDS-PAGE
• Storage buffer: pH: 8.00Constituents:0.32% Tris HCl, 0.58% Sodium chloride, 0.02% DTT, 20% Glycerol
• Storage: Please see Notes section
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMDGTFLWKITNVTRRCHESA CGRTVSLFSPAFYTAKYGYKLCLRLYLNGDGTGKRTHLSL FIVIMRGEYDALLPWPFRNKVTFMLLDQNNREHAIDAFRP DLSSASFQRPQSETNVASGCPLFFPLSKLQSPKHAYVKDD TMFLKCIVETST
• Sequence Similarities: Contains 1 MATH domain.

Gene Information

• Gene Name: TRAF1 TNF receptor-associated factor 1 [ Homo sapiens ]
• Official Symbol: TRAF1
• Synonyms: TRAF1; TNF receptor-associated factor 1; EBI6
• Gene ID: 7185
• mRNA Refseq: NM_005658
• Protein Refseq: NP_005649
• MIM: 601711
• Uniprot ID: Q13077
• Chromosome Location: 9q33-q34
• Pathway: Apoptosis, organism-specific biosystem; CD40/CD40L signaling, organism-specific biosystem; HIV-1 Nef: Negative effector of Fas and TNF-alpha, organism-specific biosystem; Herpes simplex infection, organism-specific biosystem; Herpes simplex infection, conserved biosystem
• Function: protein binding; zinc ion binding