Recombinant Human TRAF1, His-tagged

Cat.No. : TRAF1-29978TH
Product Overview : Recombinant fragment of Human TRAF1 fused to a 21 amino acid His tag at the N terminus; 172aa, 19.5 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 151 amino acids
Description : The protein encoded by this gene is a member of the TNF receptor (TNFR) associated factor (TRAF) protein family. TRAF proteins associate with, and mediate the signal transduction from various receptors of the TNFR superfamily. This protein and TRAF2 form a heterodimeric complex, which is required for TNF-alpha-mediated activation of MAPK8/JNK and NF-kappaB. The protein complex formed by this protein and TRAF2 also interacts with inhibitor-of-apoptosis proteins (IAPs), and thus mediates the anti-apoptotic signals from TNF receptors. The expression of this protein can be induced by Epstein-Barr virus (EBV). EBV infection membrane protein 1 (LMP1) is found to interact with this and other TRAF proteins; this interaction is thought to link LMP1-mediated B lymphocyte transformation to the signal transduction from TNFR family receptors. Three transcript variants encoding two different isoforms have been found for this gene.
Conjugation : HIS
Molecular Weight : 19.500kDa
Form : Liquid
Purity : >95% by SDS-PAGE
Storage buffer : pH: 8.00Constituents:0.32% Tris HCl, 0.58% Sodium chloride, 0.02% DTT, 20% Glycerol
Storage : Please see Notes section
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMDGTFLWKITNVTRRCHESA CGRTVSLFSPAFYTAKYGYKLCLRLYLNGDGTGKRTHLSL FIVIMRGEYDALLPWPFRNKVTFMLLDQNNREHAIDAFRP DLSSASFQRPQSETNVASGCPLFFPLSKLQSPKHAYVKDD TMFLKCIVETST
Sequence Similarities : Contains 1 MATH domain.
Gene Name TRAF1 TNF receptor-associated factor 1 [ Homo sapiens ]
Official Symbol TRAF1
Synonyms TRAF1; TNF receptor-associated factor 1; EBI6;
Gene ID 7185
mRNA Refseq NM_005658
Protein Refseq NP_005649
MIM 601711
Uniprot ID Q13077
Chromosome Location 9q33-q34
Pathway Apoptosis, organism-specific biosystem; CD40/CD40L signaling, organism-specific biosystem; HIV-1 Nef: Negative effector of Fas and TNF-alpha, organism-specific biosystem; Herpes simplex infection, organism-specific biosystem; Herpes simplex infection, conserved biosystem;
Function protein binding; zinc ion binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TRAF1 Products

Required fields are marked with *

My Review for All TRAF1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon