"TRIP10" Related Products

Expand
Expand

Recombinant Human TRIP10, His-tagged

Cat.No.: TRIP10-27250TH
Product Overview: Recombinant fragment, corresponding to amino acids 1-330 of Human Cip4 isoforms 2,3 and 4 with a N terminal His tag; predicted MWt 39 kDa:
Description: Cdc42-interacting protein 4 is a protein that in humans is encoded by the TRIP10 gene.
Conjugation: HIS
Source: E. coli
Tissue specificity: Expressed in brain, colon, heart, kidney, liver, lung, megakaryocyte, ovary, pancreas, peripheral blood lymphocytes, placenta, prostate, skeletal muscle, small intestine, spleen, testis, thymus and trachea.
Form: Lyophilised:Reconstitution with 108 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MDWGTELWDQFEVLERHTQWGLDLLDRYVKFVKERTEVEQ AYAKQLRSLVKKYLPKRPAKDDPESKFSQQQSFVQILQ EVNDFAGQRELVAENLSVRVCLELTKYSQEMKQERKMH FQEGRRAQQQLENGFKQLENSKRKFERDCREAEKAAQTAE RLDQDINATKADVEKAKQQAHLRSHMAEESKNEYAAQL QRFNRDQAHFYFSQMPQIFDKLQDMDERRATRLGAGYG LLSEAELEVVPIIAKCLEGMKVAANAVDPKNDSHVLIELHKSGFARPGDVEFEDFSQPMNRAPSDSSLGTPSDGRPEL RGPGRSRTKRWPFGKKNKTV
Sequence Similarities: Belongs to the FNBP1 family.Contains 1 FCH domain.Contains 1 REM (Hr1) repeat.Contains 1 SH3 domain.
Gene Name: TRIP10 thyroid hormone receptor interactor 10 [ Homo sapiens ]
Official Symbol: TRIP10
Synonyms: TRIP10; thyroid hormone receptor interactor 10; salt tolerator , STOT; cdc42-interacting protein 4; Cdc42 interacting protein; CIP4; HSTP; STP;
Gene ID: 9322
mRNA Refseq: NM_004240
Protein Refseq: NP_004231
MIM: 604504
Uniprot ID: Q15642
Chromosome Location: 19p13.3
Pathway: Insulin Pathway, organism-specific biosystem; Insulin signaling pathway, organism-specific biosystem; Insulin signaling pathway, conserved biosystem; Insulin-mediated glucose transport, organism-specific biosystem; Rho GTPase cycle, organism-specific biosystem;
Function: identical protein binding; lipid binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.