Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human TSC22D3

Cat.No. : TSC22D3-29062TH
Product Overview : Recombinant full length Human GilZ / TilZ isoform 2 with N-terminal proprietary tag.Mol Wt 48.07 kDa inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
Description : The protein encoded by this gene shares significant sequence identity with the murine TSC-22 and Drosophila shs, both of which are leucine zipper proteins, that function as transcriptional regulators. The expression of this gene is stimulated by glucocorticoids and interleukin 10, and it appears to play a key role in the anti-inflammatory and immunosuppressive effects of this steroid and chemokine. Transcript variants encoding different isoforms have been identified for this gene.
Protein length : 200 amino acids
Molecular Weight : 48.070kDa inclusive of tags
Source : Wheat germ
Tissue specificity : Expressed in brain, lung, spleen and skeletal muscle. Lower levels detected in heart and kidney. Not detected in the pancreas. In non-lymphoid tissues, in the absence of inflammation, the major source of constitutive expression is the macrophage lineage.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MAQSKLDCRSPVGLDCCNCCLDLAHRSGLQRGSSGENNNP GSPTVSNFRQLQEKLVFENLNTDKLNSIMRQDSLEPVLRD PCYLINEGICNRNIDQTMLSILLFFHSASGASVVAIDNKI EQAMDLVKNHLMYAVREEVEILKEQIRELVEKNSQLEREN TLLKTLASPEQLEKFQSCLSPEEPAPESPQVPEAPGGSAV
Sequence Similarities : Belongs to the TSC-22/Dip/Bun family.
Gene Name : TSC22D3 TSC22 domain family, member 3 [ Homo sapiens ]
Official Symbol : TSC22D3
Synonyms : TSC22D3; TSC22 domain family, member 3; delta sleep inducing peptide, immunoreactor , DSIPI; TSC22 domain family protein 3; DIP; GILZ; glucocorticoid induced leucine zipper; hDIP; TSC 22R;
Gene ID : 1831
mRNA Refseq : NM_001015881
Protein Refseq : NP_001015881
MIM : 300506
Uniprot ID : Q99576
Chromosome Location : Xq22.3
Function : MyoD binding; sequence-specific DNA binding transcription factor activity;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends