Recombinant Full Length Human TSC22D3 Protein

Cat.No. : TSC22D3-531HF
Product Overview : Recombinant full length Human GilZ / TilZ isoform 2 with N-terminal proprietary tag.Mol Wt 48.07 kDa inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Protein Length : 200 amino acids
Description : The protein encoded by this gene shares significant sequence identity with the murine TSC-22 and Drosophila shs, both of which are leucine zipper proteins, that function as transcriptional regulators. The expression of this gene is stimulated by glucocorticoids and interleukin 10, and it appears to play a key role in the anti-inflammatory and immunosuppressive effects of this steroid and chemokine. Transcript variants encoding different isoforms have been identified for this gene.
Form : Liquid
Molecular Mass : 48.070kDa inclusive of tags
AA Sequence : MAQSKLDCRSPVGLDCCNCCLDLAHRSGLQRGSSGENNNP GSPTVSNFRQLQEKLVFENLNTDKLNSIMRQDSLEPVLRD PCYLINEGICNRNIDQTMLSILLFFHSASGASVVAIDNKI EQAMDLVKNHLMYAVREEVEILKEQIRELVEKNSQLEREN TLLKTLASPEQLEKFQSCLSPEEPAPESPQVPEAPGGSAV
Purity : Proprietary Purification
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
Storage Buffer : pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.
Gene Name TSC22D3 TSC22 domain family, member 3 [ Homo sapiens ]
Official Symbol TSC22D3
Synonyms TSC22D3; TSC22 domain family, member 3; delta sleep inducing peptide, immunoreactor , DSIPI; TSC22 domain family protein 3; DIP; GILZ; glucocorticoid induced leucine zipper; hDIP; TSC22R
Gene ID 1831
mRNA Refseq NM_001015881
Protein Refseq NP_001015881
MIM 300506
UniProt ID Q99576

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TSC22D3 Products

Required fields are marked with *

My Review for All TSC22D3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon