Recombinant Full Length Human TSC22D3 Protein

• Cat.No.: TSC22D3-531HF
• Product Overview: Recombinant full length Human GilZ / TilZ isoform 2 with N-terminal proprietary tag.Mol Wt 48.07 kDa inclusive of tag.

Specification

• Description: The protein encoded by this gene shares significant sequence identity with the murine TSC-22 and Drosophila shs, both of which are leucine zipper proteins, that function as transcriptional regulators. The expression of this gene is stimulated by glucocorticoids and interleukin 10, and it appears to play a key role in the anti-inflammatory and immunosuppressive effects of this steroid and chemokine. Transcript variants encoding different isoforms have been identified for this gene.
• Source: In Vitro Cell Free System
• Species: Human
• Form: Liquid
• Molecular Mass: 48.070kDa inclusive of tags
• Protein Length: 200 amino acids
• AA Sequence: MAQSKLDCRSPVGLDCCNCCLDLAHRSGLQRGSSGENNNP GSPTVSNFRQLQEKLVFENLNTDKLNSIMRQDSLEPVLRD PCYLINEGICNRNIDQTMLSILLFFHSASGASVVAIDNKI EQAMDLVKNHLMYAVREEVEILKEQIRELVEKNSQLEREN TLLKTLASPEQLEKFQSCLSPEEPAPESPQVPEAPGGSAV
• Purity: Proprietary Purification
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
• Storage Buffer: pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.

Gene Information

• Gene Name: TSC22D3 TSC22 domain family, member 3 [ Homo sapiens ]
• Official Symbol: TSC22D3
• Synonyms: TSC22D3; TSC22 domain family, member 3; delta sleep inducing peptide, immunoreactor , DSIPI; TSC22 domain family protein 3; DIP; GILZ; glucocorticoid induced leucine zipper; hDIP; TSC22R
• Gene ID: 1831
• mRNA Refseq: NM_001015881
• Protein Refseq: NP_001015881
• MIM: 300506
• UniProt ID: Q99576