"TUSC1" Related Products

Recombinant Human TUSC1, His-tagged

Cat.No.: TUSC1-31634TH
Product Overview: Recombinant fragment, corresponding to amino acids 59-212 of Human TUSC1 with N terminal His tag; Predicted MWt 19 kDa.
Description: This gene is located within the region of chromosome 9p that harbors tumor suppressor genes critical in carcinogenesis. It is an intronless gene which is downregulated in non-small-cell lung cancer and small-cell lung cancer cell lines, suggesting that it may play a role in lung tumorigenesis.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitute with 118 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: QQLEERFADLAASHLEAIRARDEWDRQNARLRQENARLRL ENRRLKRENRSLFRQALRLPGEGGNGTPAEARRVPEEA STNRRARDSGREDEPGSPRALRARLEKLEAMYRRALLQ LHLEQRGPRPSGDKEEQPLQEPDSGLRSRDSEPSGPWL
Gene Name: TUSC1 tumor suppressor candidate 1 [ Homo sapiens ]
Official Symbol: TUSC1
Synonyms: TUSC1; tumor suppressor candidate 1; tumor suppressor candidate gene 1 protein; TSG 9;
Gene ID: 286319
mRNA Refseq: NM_001004125
Protein Refseq: NP_001004125
MIM: 610529
Uniprot ID: Q2TAM9
Chromosome Location: 9p21.2

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.