"UBE2E3" Related Products

Expand
Expand

Recombinant Human UBE2E3

Cat.No.: UBE2E3-31658TH
Product Overview: Recombinant full length Human UBE2E3 expressed in Saccharomyces cerevisiae; 207 amino acids, MWt 22.9 kDa. Protein is tagged with 25 kDa proprietary tag.
Description: The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. The encoded protein shares 100% sequence identity with the mouse and rat counterparts, which indicates that this enzyme is highly conserved in eukaryotes. Two alternatively spliced transcript variants encoding the same protein have been found for this gene.
Tissue specificity: Ubiquitously expressed at low levels. Highly expressed in skeletal muscle.
Form: Liquid
Purity: >90% by SDS-PAGE
Storage buffer: Preservative: NoneConstituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
Sequences of amino acids: MSSDRQRSDDESPSTSSGSSDADQRDPAAPEPEEQEERKP SATQQKKNTKLSSKTTAKLSTSAKRIQKELAEITLDPP PNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFSSDYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPA LTISKVLLSICSLLTDCNPADPLVGSIATQYLTNRAEH DRIARQWTKRYAT
Sequence Similarities: Belongs to the ubiquitin-conjugating enzyme family.
Gene Name: UBE2E3 ubiquitin-conjugating enzyme E2E 3 [ Homo sapiens ]
Official Symbol: UBE2E3
Synonyms: UBE2E3; ubiquitin-conjugating enzyme E2E 3; ubiquitin conjugating enzyme E2E 3 (homologous to yeast UBC4/5) , ubiquitin conjugating enzyme E2E 3 (UBC4/5 homolog, yeast); ubiquitin-conjugating enzyme E2 E3; UbcH9;
Gene ID: 10477
mRNA Refseq: NM_182678
Protein Refseq: NP_872619
MIM: 604151
Uniprot ID: Q969T4
Chromosome Location: 2q31.3
Pathway: Adaptive Immune System, organism-specific biosystem; Antigen processing: Ubiquitination & Proteasome degradation, organism-specific biosystem; Class I MHC mediated antigen processing & presentation, organism-specific biosystem;
Function: ATP binding; acid-amino acid ligase activity; ligase activity; nucleotide binding; ubiquitin-protein ligase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.