Recombinant Human UBE2E3
Cat.No. : | UBE2E3-31658TH |
Product Overview : | Recombinant full length Human UBE2E3 expressed in Saccharomyces cerevisiae; 207 amino acids, MWt 22.9 kDa. Protein is tagged with 25 kDa proprietary tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Tag : | Non |
Description : | The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. The encoded protein shares 100% sequence identity with the mouse and rat counterparts, which indicates that this enzyme is highly conserved in eukaryotes. Two alternatively spliced transcript variants encoding the same protein have been found for this gene. |
Tissue specificity : | Ubiquitously expressed at low levels. Highly expressed in skeletal muscle. |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MSSDRQRSDDESPSTSSGSSDADQRDPAAPEPEEQEERKP SATQQKKNTKLSSKTTAKLSTSAKRIQKELAEITLDPP PNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFSSDYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPA LTISKVLLSICSLLTDCNPADPLVGSIATQYLTNRAEH DRIARQWTKRYAT |
Sequence Similarities : | Belongs to the ubiquitin-conjugating enzyme family. |
Full Length : | Full L. |
Gene Name | UBE2E3 ubiquitin-conjugating enzyme E2E 3 [ Homo sapiens ] |
Official Symbol | UBE2E3 |
Synonyms | UBE2E3; ubiquitin-conjugating enzyme E2E 3; ubiquitin conjugating enzyme E2E 3 (homologous to yeast UBC4/5) , ubiquitin conjugating enzyme E2E 3 (UBC4/5 homolog, yeast); ubiquitin-conjugating enzyme E2 E3; UbcH9; |
Gene ID | 10477 |
mRNA Refseq | NM_182678 |
Protein Refseq | NP_872619 |
MIM | 604151 |
Uniprot ID | Q969T4 |
Chromosome Location | 2q31.3 |
Pathway | Adaptive Immune System, organism-specific biosystem; Antigen processing: Ubiquitination & Proteasome degradation, organism-specific biosystem; Class I MHC mediated antigen processing & presentation, organism-specific biosystem; |
Function | ATP binding; acid-amino acid ligase activity; ligase activity; nucleotide binding; ubiquitin-protein ligase activity; |
◆ Recombinant Proteins | ||
UBE2E3-3532H | Recombinant Human UBE2E3, GST-tagged | +Inquiry |
UBE2E3-647H | Active Recombinant Human UBE2E3 Protein, His-tagged | +Inquiry |
UBE2E3-31658TH | Recombinant Human UBE2E3 | +Inquiry |
UBE2E3-0028H | Recombinant Human UBE2E3 Protein (S2-T207), His/Strep tagged | +Inquiry |
UBE2E3-4135C | Recombinant Chicken UBE2E3 | +Inquiry |
◆ Cell & Tissue Lysates | ||
UBE2E3-580HCL | Recombinant Human UBE2E3 293 Cell Lysate | +Inquiry |
UBE2E3-581HCL | Recombinant Human UBE2E3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All UBE2E3 Products
Required fields are marked with *
My Review for All UBE2E3 Products
Required fields are marked with *